KEGG   Brachypodium distachyon: 100835314Help
Entry
100835314         CDS       T01717                                 

Definition
serine palmitoyltransferase 2-like
Orthology
K00654  
serine palmitoyltransferase [EC:2.3.1.50]
Organism
bdi  Brachypodium distachyon
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Sphingosine biosynthesis
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bdi00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 489 aa AA seqDB search
MVRLPYLTALTTLVSYGLLFAFGHFRDFFRRILDAGKSSDNLKGYAPICLGYEDFYTRRL
YLRIQDCFGRPIASAPDAWVDVVERVSNDCNKTLQRTTKTSKCLNLGSYNYLGFAAADEY
CTPRVIESLKKYSASTCSARVDGGNTKLHTELEELVARFVGKPAAILFGMGYVTNSAIIP
VLIGKGGLIVSDSLNHISIVNGARGSGATVRVFQHNNPAHLEDVLREQIAGGQPRTHRPW
KKIIVIVEGIYSMEGELCNLPEIMAVCKKYKAYTYLDEAHSIGAVGKTGRGVCELLGVDP
ADVDIMMGTFTKSFGSCGGYIAASKEIIQHLKHQCPAHIYATSMSPPAVQQVISAIKVVL
GEDGSNRGAKKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECL
RQNVAVVTVAFPATPLLLARARICISASQSREDLIKGLEVISKVGDLVGIKYFPVEQEKT
SADKLKKLQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggctgccttacctgacggcgctcaccacgctcgtcagctacggcctactcttc
gccttcggccacttccgcgatttcttccgcaggatcctcgacgccggcaaatccagcgac
aacctcaagggttacgcgcccatctgcctggggtacgaggatttctacacgcgccgcctc
tatctccgaatccaggattgttttggccgaccgatcgctagtgcaccagatgcttgggtc
gatgtagttgagcgtgtctcaaatgactgtaacaagacactccaacgtaccacaaaaaca
tccaagtgccttaacttgggttcctacaactaccttggtttcgctgccgcagatgagtac
tgcactcctcgtgttatcgagtcactcaagaaatactctgccagcacttgcagtgcccga
gttgacggaggaaatactaagctgcacacagaactcgaggagctggttgcacgatttgtt
ggcaagcctgcagctattctttttggcatgggttatgtgacgaactctgcgatcattcct
gttttgattgggaagggtgggctgatagtcagtgattcattgaaccatatttctatagtg
aatggagctagaggatcaggggctactgtccgggtttttcaacataacaaccctgcacat
ttggaagacgtattgagagagcagattgcagggggtcagcctcgtacacacaggccatgg
aagaagataattgtgattgttgagggaatttatagcatggaaggggagctatgcaacctc
cctgagattatggcagtctgcaaaaagtacaaggcttacacttatctagatgaggcacac
agtattggtgctgttggaaagacgggcagaggtgtatgtgaactactaggagtggatcca
gctgatgttgatattatgatgggaacatttactaaatcctttggatcgtgtggaggttac
attgcagcatcaaaagagatcattcagcatctcaaacaccaatgcccagcccatatttat
gcaacatccatgtcacctccggcagtccagcaggtcatctctgcaatcaaggttgtcctt
ggggaagatggatctaacagaggggccaagaaacttgctcagattcgggagaacagcaat
tttttccgttcagagcttcagaaaatgggttttgaggttctgggagataatgactcaccg
gttatgcctatcatgctttacaatcctgctaaaattcctgcattctcaagggagtgcctg
aggcaaaatgttgccgttgttactgttgcatttcctgctacgccactactacttgccaga
gctaggatatgcatctcagcttcccaatcgagggaggatcttattaaaggactggaggtt
atcagcaaagttggtgatcttgtgggaatcaagtactttccagttgagcaagagaagaca
tctgctgataaacttaagaagcttcagtga

DBGET integrated database retrieval system