KEGG   Brachypodium distachyon: 100835314Help
Entry
100835314         CDS       T01717                                 

Definition
serine palmitoyltransferase 2-like
Orthology
K00654  
serine palmitoyltransferase [EC:2.3.1.50]
Organism
bdi  Brachypodium distachyon
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100835314
Enzymes [BR:bdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     100835314
Amino acid related enzymes [BR:bdi01007]
 Aminotransferase (transaminase)
  Class II
   100835314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 489 aa AA seqDB search
MVRLPYLTALTTLVSYGLLFAFGHFRDFFRRILDAGKSSDNLKGYAPICLGYEDFYTRRL
YLRIQDCFGRPIASAPDAWVDVVERVSNDCNKTLQRTTKTSKCLNLGSYNYLGFAAADEY
CTPRVIESLKKYSASTCSARVDGGNTKLHTELEELVARFVGKPAAILFGMGYVTNSAIIP
VLIGKGGLIVSDSLNHISIVNGARGSGATVRVFQHNNPAHLEDVLREQIAGGQPRTHRPW
KKIIVIVEGIYSMEGELCNLPEIMAVCKKYKAYTYLDEAHSIGAVGKTGRGVCELLGVDP
ADVDIMMGTFTKSFGSCGGYIAASKEIIQHLKHQCPAHIYATSMSPPAVQQVISAIKVVL
GEDGSNRGAKKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECL
RQNVAVVTVAFPATPLLLARARICISASQSREDLIKGLEVISKVGDLVGIKYFPVEQEKT
SADKLKKLQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggctgccttacctgacggcgctcaccacgctcgtcagctacggcctactcttc
gccttcggccacttccgcgatttcttccgcaggatcctcgacgccggcaaatccagcgac
aacctcaagggttacgcgcccatctgcctggggtacgaggatttctacacgcgccgcctc
tatctccgaatccaggattgttttggccgaccgatcgctagtgcaccagatgcttgggtc
gatgtagttgagcgtgtctcaaatgactgtaacaagacactccaacgtaccacaaaaaca
tccaagtgccttaacttgggttcctacaactaccttggtttcgctgccgcagatgagtac
tgcactcctcgtgttatcgagtcactcaagaaatactctgccagcacttgcagtgcccga
gttgacggaggaaatactaagctgcacacagaactcgaggagctggttgcacgatttgtt
ggcaagcctgcagctattctttttggcatgggttatgtgacgaactctgcgatcattcct
gttttgattgggaagggtgggctgatagtcagtgattcattgaaccatatttctatagtg
aatggagctagaggatcaggggctactgtccgggtttttcaacataacaaccctgcacat
ttggaagacgtattgagagagcagattgcagggggtcagcctcgtacacacaggccatgg
aagaagataattgtgattgttgagggaatttatagcatggaaggggagctatgcaacctc
cctgagattatggcagtctgcaaaaagtacaaggcttacacttatctagatgaggcacac
agtattggtgctgttggaaagacgggcagaggtgtatgtgaactactaggagtggatcca
gctgatgttgatattatgatgggaacatttactaaatcctttggatcgtgtggaggttac
attgcagcatcaaaagagatcattcagcatctcaaacaccaatgcccagcccatatttat
gcaacatccatgtcacctccggcagtccagcaggtcatctctgcaatcaaggttgtcctt
ggggaagatggatctaacagaggggccaagaaacttgctcagattcgggagaacagcaat
tttttccgttcagagcttcagaaaatgggttttgaggttctgggagataatgactcaccg
gttatgcctatcatgctttacaatcctgctaaaattcctgcattctcaagggagtgcctg
aggcaaaatgttgccgttgttactgttgcatttcctgctacgccactactacttgccaga
gctaggatatgcatctcagcttcccaatcgagggaggatcttattaaaggactggaggtt
atcagcaaagttggtgatcttgtgggaatcaagtactttccagttgagcaagagaagaca
tctgctgataaacttaagaagcttcagtga

DBGET integrated database retrieval system