KEGG   Brachypodium distachyon: 100835453Help
Entry
100835453         CDS       T01717                                 

Definition
(RefSeq) endoglucanase 23-like
  KO
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bdi  Brachypodium distachyon
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100835453
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     100835453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 413 aa AA seqDB search
MAFTATMLSWSVIEFGDLMPPAERRHAVAAVRWATDYLLKTIAHPGVLFIQVGDPWKDHE
CWERPEGMDTLRTVYNVTAPRTGSDVAGETAAALAAASIVFRGDGADEEYAERLLAGAKT
AFEFADAHKGAYSDDPGLRAGGCPFYCDYNGYQDELLWGAAWLRRASGDDTFLKYIKDNG
KTLGAEEGFNEFGWDNKHAGLNILVAKEFMDGNALSMESFKQSADNFICTLIPQSSSQHI
QYTPGGLIYKTGGSNMQHVTSFSFLLLTYAKYLSNSSHTINCGGISVGPETLQLQAKKQV
DYILGDNPIKMSYMVGYGDRYPQRIHHRGSSLPSIKTHSQRMACKDGTPYYESSNSNPNP
LIGAVVGGPGEDDSYEDNRADFRKSEPTTYINAPLVGVLAYFVANPNPGHIRH
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcacggccaccatgctgtcctggagcgtcatcgagttcggcgacctcatgccg
cccgccgagcgccggcacgccgtcgccgccgtgcgctgggccaccgactacctcctcaag
accatcgcccaccccggcgtcctcttcatccaggtgggagacccgtggaaggaccacgag
tgctgggagaggccggagggcatggacacgctgcgcacggtgtacaacgtgaccgcgcca
cggacggggtcggacgtggccggggagactgcggcggcgctggccgcggcgtccatcgtg
ttccgcggcgacggcgctgacgaggagtacgccgagcggctgctcgcgggcgccaagacg
gcgttcgagttcgccgacgctcacaagggcgcctacagcgacgaccccgggctcagggca
ggtggctgccccttctactgcgactacaacggttaccaggatgagcttctgtggggggcg
gcgtggctaaggagggcctctggggacgacacattcctgaagtacatcaaggacaacggc
aagaccctcggggcagaggaaggcttcaacgagttcgggtgggacaacaagcatgccggt
ctcaacatcctcgtggccaaggagttcatggacggcaacgcgctgtctatggagtctttc
aaacagtctgcagacaacttcatttgcacgctcatcccgcaatcctcgtcgcagcacatc
cagtacacacctggggggctgatctacaagactggaggcagcaatatgcagcatgtcacc
tccttttccttcctgctcctaacctatgccaagtatctctctaattcctctcacactatc
aactgcgggggcatttcagttggtccagaaactcttcagcttcaagccaaaaaacaggtt
gattatatattgggagataatccgatcaaaatgtcctacatggtcgggtacggcgaccga
tatcctcagcggatccaccatagaggatcatcgttgccttcgatcaagacgcattcccag
cgaatggcgtgcaaagatggcacgccttactacgagtcatctaactcgaaccctaacccg
ttgatcggtgcggtcgttggggggccaggtgaggatgattcttatgaggacaaccgtgct
gatttcaggaaatctgaaccgactacctacatcaatgctcccttagtaggcgttcttgcc
tactttgttgccaacccaaacccaggccatatcagacactga

DBGET integrated database retrieval system