KEGG   Brachypodium distachyon: 100835842Help
Entry
100835842         CDS       T01717                                 

Definition
serine/threonine-protein kinase TOR-like
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
bdi  Brachypodium distachyon
Brite
Protein kinases [BR:bdi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100835842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 2466 aa AA seqDB search
MKPSPHFPEIGKKSKDLVAKDHSFNIGAYISSGADAISAALRKHVEEEARDLSGETFLRF
MDQLYEQIYILLQSNDVSENLLALRAIDALIDMPFGEGASKVSKFASFLRNVFEVKRDPE
ILVPASTVLGHLAKAGGAMTAEEVERQIKTALGWLGGDRVEYRRFAAVLILKEMAENAST
LFNVHVTEFVDAIWVALRDPKQAVRERAVEALRACLHVIEKRETRWRVQWYYRMCEAAQV
GLGKNASVHSIHGSLLAVGELLRNTGEFMMSRYREVADIVLTYLKHRDQLVRRSITSLLP
RIAHFLRDRFVTNYLKICMDHILFVLRTPDERASGFVALGEMAGALGAELVPSLPLISPH
LHDAIAPRRGRPSLEAITCVGSFAKAMGLAMEPHIRGGLLDAMFSAGLSEKLVDALESIS
TSIPSLLPTIQERLLDCISQALPKSSTRPGATVNRTTRSSSLQQFVDSNGPVHVQLALRT
LATFNFKGHELLEFARDSVTLYLEDEDSSTRKAAAICCCRLVAHSFSASSTSQFSSNRSN
RIGGAKRRRLVEEIVEKLLIAAVADADVGVRSSVFKALYRNPTFDDFLAQADILTSIFVA
LNDEEYGVRELAISVAGRLSEKNPAYVLPALRRYLIQLLTYLDQSMDSKCREESARLLGC
LIRSCARLILPYIAPIHKALVARLCEGAGPMANNVLAAGVLATVGELAKVGGFSMRQYLP
ELMPLVVDALLDGGAVSKREVAVATLGQVIQSTGYVIAPYNEYPQLLGLLLKLLNGELEW
STRLEVLKVLGIMGALDPHAHKRNQHNLPGQHREVLRPTIETAQHIVSMEETPTDFWPSF
QHLKTTIRQLQLILXCEFSEILHFQVIIKWLLALLSLFLSQWALAVXPYLPKVLPELFRA
VRMCEDGGLKEFITWKIGTLVSIVRQHIRKYLQDILSLVSELWISSFSLPAPKRTIQGPQ
ASPVLHLVEQLCLALNDEFRMYLLHILPSCIQVLGDAERCNDYYHVPDILHTLEVFGGNL
DEHMHLVAPVLVRLFKVELVDIRRRAIVTLTKLIPRVQVGTHVSALVQHLKLVLDGNNDD
LRKDAAEALCSLAHALGEEFTIFIPSIRKLLVKHHLRYRKWDEIENRLLRREPLISDNMS
VQKYTQCPPDVISDPLDDVDGVPSEEADETQRQPGSHRVNDVRLRSAGEASQRSTRDDWT
EWMRHFSIALLKESPSPALRTCARLAQLQPSVGRELFAAGFASCWAEMTESSQEQLVRSL
KTAFSSQNIPAEILATLLNLAEFMEHDEKPLPIDTRLLGALAEKCRAYAKALHYKEMEFE
AVFSKKMGANPVTVVESLIHINNQLHQHEAAIGILTYSQQHLEVQLKESWYEKLHRWDEA
LRAYTVKSSQASGPLQNLDATLGRMRCLASLARWEDLSTLCREQWTGAEQSARLEMAPMA
ANAAWHMGEWEQMSEYVSRLDDGDENKLRLLGNTTASGDGSSNGAFFRAVLSVRCKKYEE
ARVYVERARRCLATELAALVLESYERAYNNMVRVQQLSELEEVIDYCTLPTESPIADGRR
ELIRNMWNERIKGTKRNVEVWQALLAVRELVLPPNEDRDTWIKFAKLCWKSGRISQAKST
LVKLLQFDPESSPELTLYHGHPQVVLAYLKYQYAVGDELKRKDAFSRLQDLSVQIATATN
SYPGTLVSQGAVSSAGVPLIARVYLTLASWKRALSPGLDDDAIQEILVSYKNATLSAKDW
GKAWHSWALFNTEVMSRYTLRGRPDIAGKYVVAAVTGYFYSIACASTTKGVDDSLQDILR
LLTLWFNHGATSEVQMALQKGFSLVKIEMWLVVLPQIIARIHSNNRIVRELIQALLVRIG
KGHPQALMYPLLVACKSISILRQRAAQEVVDKIRQHSGGLVDQAQLVSKELIRVAILWHE
MWHEALEEASRMYFGEHNIEGMLAVLEPLHAMLERGAETIKENTFIQAYGHELLEAHECC
LKYRATGEDAELTKAWDLYYHVFRRIDKQLPSLTTLDLHSVSPELLKCRKLELAVPGTYS
ADSPLVTIEYFVPQLIVITSKQRPRKLTIHGSDGNDYAFLLKGHEDLRQDERVMQLFGLV
NTLLENSRKTSEKDLSIQRYAVIPLSPNSGLIGWVPNCDTLHALIREYRDARKIFLNQEH
RLMLAFAPDYDHLPLIAKVEVFEHALQNTEGNDLAKVLWLKSRTSEIWLERRTNYTRSLA
VMSMAGYLLGLGDRHPSNLMLDRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVK
AMEVSGIEGTFRTTCENVMQVLRTNKDSVMAMMEAFVHDPLINWRLFNFNEVPQVSNYGN
AHTQPVVSSEETAPNEELMPPLRGAREKELLQAVNQLGDANEVLNERAVAVMARMSHKLT
GRDFSSGSALSGAGSSNQHGNEHLASVDARDVEPGLSVKVQVQKLILQASSHENLCQNYV
GWCPFW
NT seq 7401 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctcgccgcacttcccggagatagggaagaagtccaaagatttggtcgccaag
gaccacagtttcaacatcggggcctacatatcatccggagcggatgctatttctgctgcc
ctgcggaaacatgttgaggaggaagctcgagacctcagcggtgaaacatttctaagattt
atggatcagctctatgaacagatatatattttactgcaaagtaacgatgtttctgaaaat
ttattggctcttcgtgctatcgatgctttgattgatatgccgtttggagaaggtgcttcg
aaggtttctaagttcgccagcttcctgagaaacgtgtttgaagttaaacgcgaccctgaa
attctagttccagcaagcacggtgcttggtcacttggcaaaagctgggggagcaatgact
gcagaggaagttgagcgacaaattaaaactgctttagggtggcttggtggggatcgagtg
gagtatcgtcgctttgcagctgtccttattctcaaagagatggccgagaatgcttccaca
cttttcaatgtccatgttactgaatttgttgatgctatatgggtagcactgagagacccc
aaacaggctgtacgtgaacgggctgtggaagcgttgcgtgcttgtcttcatgttattgaa
aagcgcgagacgcggtggcgtgtacagtggtattaccgcatgtgtgaagcagcgcaggtt
ggacttggcaaaaatgcttctgttcatagcatacatggctcattattggctgttggggaa
ttgttgaggaacactggagagtttatgatgtctaggtacagagaggtggctgatatagtc
ctcacatacttaaaacaccgggatcaacttgttcgtcgcagtataacatcacttcttcct
cgaattgcccacttcctgcgcgacagattcgtgaccaactacctaaagatttgcatggat
catatcctctttgttctacgtacacctgatgagcgtgctagtgggtttgttgctcttgga
gagatggctggtgctttgggtgctgaacttgtgcccagtttgcccttaatttccccacat
ttgcatgatgcaattgctcctcgcagaggacggccatctcttgaggcaattacctgcgta
ggaagctttgcgaaagccatgggtcttgcaatggaacctcatattcgtggtggacttcta
gatgccatgttttctgctggtctttctgagaaacttgtagatgcacttgagtctataagt
acaagcatcccgtctctactgccaacaatacaagagcgtctcttggattgtatatctcaa
gcacttcctaagtcatccacgaggccaggtgctactgttaatcgaacaaccaggtcaagc
agtttgcagcagtttgtggattctaatggtccagtccatgtccaacttgcactgcggact
ctagcaaccttcaactttaagggtcatgagctcctggaatttgcgagagatagtgtcact
ctttatctggaagacgaggatagcagtacccgaaaggctgctgcaatatgctgttgcaga
ttagttgcacactctttttctgcttcgtctacttcacagtttagttcaaatagatcaaac
cggattggaggagccaagcgtcgtcgccttgtggaagagatagtcgaaaaacttcttatt
gctgcagttgctgatgctgacgttggtgttaggagttcagtcttcaaggctctatatcgg
aacccgacctttgatgactttttggcccaagctgacatcctcacttcaatttttgttgcc
ttaaatgatgaggagtatggcgtcagggaattggcaatatcagttgcaggcagattatct
gaaaaaaatcctgcatatgtactgcctgcccttcgtcgctatcttatacagttgctgacc
tatcttgatcaaagtatggatagtaagtgtagagaggaaagtgctagattgttgggttgc
ttaattaggagctgtgcacggttaatacttccttatattgctccaattcacaaggctctg
gtggctagactttgtgaaggagcagggccaatggctaataatgtgcttgctgcaggagtg
cttgctactgttggagaactggccaaagtgggtggtttttcaatgaggcagtatcttcct
gagctaatgcctctagtcgtggatgctcttttggatggtggtgctgtgagtaagagggaa
gtggcagtagcaacccttggacaagttattcaaagcacaggctatgttattgctccctac
aatgagtatcctcaattgcttggcttactcttgaaattgctgaatggtgaattggaatgg
tcaaccagactggaagtgctgaaggttttagggattatgggtgcattggaccctcatgca
cataagcgtaatcaacataatctacctggtcaacatagagaggttctacggccaacaatt
gagactgcacaacatatcgtttccatggaagagacaccaactgatttctggccatctttt
cagcatctgaagactactattcgacagttgcaattaattctctgatgcgaattctccgag
atccttcactttcaagttatcatcaaatggttgttggctctcttatctttgtttttaagt
caatgggccttggctgtgnttccttatttaccaaaggttctccctgagctattccgtgct
gttcgcatgtgcgaggatggtggtttgaaagagttcataacctggaaaattgggacatta
gtatctattgttaggcagcacatccggaagtatttacaagacatactatctcttgtctcc
gaattatggatctcctcgttcagcttgcctgcaccaaagcggaccatacagggtccacag
gcttctccagttcttcatcttgttgaacaactgtgcttagcattgaatgatgaattcaga
atgtatttgctccatattttaccgagttgtattcaagtcttgggggatgctgaacgctgc
aatgattattaccatgttcctgatatattacacacacttgaagtttttggcggaaatttg
gatgagcacatgcacttggttgctccggtgcttgttcgtttatttaaagtggagctagtt
gatattagacggcgtgccattgtcactttgactaagcttatacctagggtgcaggttggt
actcatgtgtctgctttggttcagcatctgaagcttgttttggatgggaacaatgatgat
ctacggaaagatgctgctgaggcactctgctcactcgcacacgctcttggagaagaattt
accattttcataccatcaatacgcaaacttcttgtgaagcaccatttgcggtacagaaaa
tgggatgagattgaaaatcgattattaaggcgagagcccctcatctccgataacatgtct
gtacaaaagtacacacagtgtccacctgatgtcattagcgacccccttgatgatgttgat
ggcgttccctctgaggaagctgatgaaacacaacggcaaccaggaagtcatcgagtcaat
gatgttcggttgagaagtgctggcgaggcttctcagagaagtactagagatgattggact
gaatggatgaggcacttcagtattgcacttctcaaagagtcaccatcaccagctctacgt
acttgtgcaaggctagctcagcttcagccctctgttggtcgcgagttgtttgctgcgggt
tttgcaagttgctgggccgaaatgaccgaatcatcccaggagcaactagtgagaagtctc
aagacagcattctcatctcagaacatacctgcagaaattcttgcgacgctgttgaacttg
gcagagtttatggaacatgatgagaaaccccttccaattgatactagactgcttggcgca
cttgctgagaagtgtcgagcatatgccaaagccctacattataaagaaatggagtttgag
gctgtattttccaagaagatgggggcaaatccggttacggtggttgagtcacttattcat
attaataatcaactacaccagcatgaggcagctattggaatattgacttactcacaacag
catctagaagttcagttgaaggaatcctggtatgagaaattgcaccgttgggatgaggcc
ctaagggcatatactgtgaagtcatctcaagcatctggcccattacaaaacttggatgct
acattggggcggatgaggtgtctagcgtccttggctcgttgggaagatttgagcacatta
tgcagggagcaatggactggcgcagaacaatctgctcggctggaaatggctccaatggct
gcaaatgctgcttggcatatgggtgagtgggaacagatgtctgaatatgtttctcgtctg
gatgatggggatgaaaacaagctccggttgttgggtaacacaacagctagtggtgatgga
agcagtaatggtgctttctttagggctgttctttcagttcgttgcaaaaagtatgaagaa
gctcgtgtatatgttgagagagctcggcggtgtttggcaactgaacttgcagcattggta
cttgagagttatgaacgtgcttataataacatggtgcgggttcaacagctttcagaactg
gaagaggtgattgattactgcactcttcccacggaaagtccaattgctgatgggcgaagg
gaacttattcgtaatatgtggaacgagcgcattaaaggaacaaaacggaatgttgaggtg
tggcaagctctacttgctgttagagagctggttcttcctcctaatgaagacagagatacc
tggataaaatttgctaaactttgttggaagagtggacgtatcagtcaggctaaatctact
ttagtcaaactcttgcagtttgaccctgaatcttctcctgaattgacactttatcatggg
catcctcaagtagtactggcttaccttaaataccagtatgctgttggagacgagctgaaa
cggaaggatgcattttctaggctacaggatctgtctgtgcagattgctactgccacaaat
agttaccctggaacattagtaagccaaggtgctgtgtcaagtgctggagtaccgctgatt
gctcgtgtctatttgacacttgctagctggaagagagcactgtcacctgggttagatgat
gacgccatccaagaaatattggtttcgtacaaaaatgccacactgagtgccaaggactgg
ggcaaggcatggcactcgtgggctttgttcaacactgaagtcatgtcccgctatactttg
cgaggccggccagatattgctggaaaatatgttgttgcagcagtaactggatatttctac
tctattgcatgtgcatctacaaccaaaggtgttgatgatagcttacaggatatccttcgt
ctcttgactctttggttcaatcatggggctacttcagaggttcaaatggcattgcagaaa
ggcttttcacttgtgaagattgaaatgtggttggttgtgctgccccagataattgcaagg
atccattcgaacaatcgaattgttagagaactgatacaggcattgctagttcgaattgga
aaggggcatccgcaggcattgatgtatcctcttttggttgcttgcaaatcaataagtata
ttaagacaacgcgcagcgcaggaggttgttgataagatccgtcagcacagtggaggtctt
gttgatcaggcacagcttgtttcaaaagaactgatacgagttgccattttgtggcatgag
atgtggcatgaggctcttgaggaagctagcaggatgtattttggtgagcacaacatcgaa
ggaatgcttgcagtacttgagccattgcacgcaatgcttgagaggggagctgagacaata
aaagagaatactttcattcaggcttatggacatgaattactggaagcccatgaatgctgc
ctaaaatatcgcgctactggagaggatgctgagctaactaaggcatgggacttgtattac
catgttttcagaagaatcgataaacagcttcccagtcttacaactcttgatttgcactct
gtttcacctgagctgctgaaatgtcgaaagctggagcttgctgtaccaggaacttattct
gcagattctccactcgtgactatcgagtattttgttccacaattgattgttatcacatcc
aaacaaagaccaaggaaactgacaattcatggaagtgatgggaatgattatgcattcttg
cttaaaggtcatgaagatttaaggcaagatgaacgtgttatgcagctttttggtctggtg
aatactctcctggagaactcaaggaagacatcagagaaagatttgtcaatccaaagatat
gctgttattcctttgtctcctaacagtggtttaattggatgggttccaaattgtgacaca
cttcatgctctgatccgtgaatacagagatgcaaggaagattttcttaaatcaagagcac
agacttatgctggcgtttgcccctgattatgaccacttacccctcattgcaaaggtggaa
gtattcgagcatgctctgcaaaataccgaaggaaatgaccttgccaaggttctctggctg
aaaagtcgaacctctgaaatatggcttgaacggcgtacaaattatacaagaagcctggcc
gttatgagcatggccggctatttgcttggtttaggagatcgtcatccaagcaatcttatg
ttagatcggtatagtgggaaaattttacatattgactttggagattgctttgaggcgtca
atgaatcgggaaaagtttcctgaaaaagtaccgttccgcttgactagaatgctcgtgaaa
gccatggaagttagtggcattgagggtactttcagaacaacttgtgaaaatgtgatgcaa
gtccttcgaacaaacaaggacagtgtcatggctatgatggaggcatttgtacatgacccg
ctaatcaattggcgtttgttcaatttcaatgaagtccctcaagtttcaaactatggaaat
gctcatactcaaccagttgtcagtagtgaagaaactgctcctaatgaagagcttatgcca
cctcttcggggagcccgtgagaaggaactgctgcaggcggtcaatcaacttggtgacgct
aatgaggttttaaacgagcgcgctgtagctgtcatggcacggatgagtcacaagctaaca
gggcgtgacttctcatctgggtcagcattgtcaggagctggcagctccaaccaacatggc
aatgaacatttagcttcggtagatgctcgggacgtagaacctggtttatctgtgaaggtt
caggttcagaagcttatacttcaagcgagttcacatgaaaatttgtgccagaactacgtt
gggtggtgcccgttctggtga

DBGET integrated database retrieval system