KEGG   Brachypodium distachyon: 100836028Help
Entry
100836028         CDS       T01717                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bdi  Brachypodium distachyon
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    100836028
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     100836028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 473 aa AA seqDB search
MALRASFPGELAGGGASFLDSGRGAFRHRKVDFTFQRRDRRAVSLRRTCCSMQQGPPPAW
PGRAVVEPGRKSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQ
VKTFKPKLVAVRNESLLNELKEALADCEEMPEIIPGEQGVIEVARHLDAVTVVTGIVGCA
GLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLSE
GSLRRIILTASGGAFRDWPVERLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEA
HYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEV
TWPRLDLCKLGSLTFKAPDNVKYPSVDLAYAAGRAGGTMTGVLSAANEKAVELFIDEKIS
YLDIFKVVELTCDAHRNELVTSPSLEEIIHYDQWARKFSASLQASTGRSPVLA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcagggcttccttccccggggagctggccggaggaggagcctccttcctcgac
tccggcaggggagctttccgccaccgcaaagtggacttcacttttcaaaggagggacaga
agagcagtttcactgagaaggacatgctgttctatgcaacagggaccaccgccggcatgg
cctggtcgagctgttgttgaacctgggaggaagtcatgggatggcccaaagcctatttca
attgttggttcaactggttccataggaactcagacattggacatagttgcggagaatcct
gataaattccgagttgttgctcttgctgctggctccaacgtgactcttctagctgatcag
gtgaaaacattcaaaccaaagctggttgctgtaagaaacgagtcattacttaatgagcta
aaggaagccttagctgattgtgaggagatgccagaaattattcctggggagcaaggtgtc
atagaggttgctcgccacctagatgcagttacagttgttaccggcatagtcgggtgtgct
ggactgaagcctacagttgcagctattgaagctgggaaagatattgcactggcaaacaaa
gagacacttattgcaggcggtcctttcgtgcttcctcttgcacacaaacacaacgtgaaa
atacttcctgctgattctgagcactctgcaatatttcagtgtatacaaggcttgtctgaa
ggatcacttcgacgcattattctgactgcatcaggtggtgctttcagggactggccagtt
gagaggttgaaagatgtaaaagttgccgatgctttaaagcacccaaactggaatatgggg
aagaagatcacagtagattctgctactttgttcaacaagggtttagaagttattgaagca
cattacctgtttggtgctgaatatgatgacattgagattgttattcacccacagtctatc
atacactctatgattgaaacccaggactcgtctgtcttggctcagctgggatggccagat
atgcggttaccgatcctatacaccttatcttggccagacagaatctactgctctgaggtc
acctggccccggctagatctttgcaagttgggttcactgacattcaaagctcccgacaat
gtgaaatacccatcagtggatcttgcatacgcagctgggcgtgcagggggcaccatgaca
ggagttctcagtgctgctaacgagaaggccgtggagctcttcatcgatgaaaagatcagc
tatctggacatcttcaaggtggtggagcttacgtgcgacgctcatcgcaatgagctagtg
acaagcccgtcgcttgaggagatcatacactacgatcagtgggcgaggaagttctctgcc
agcctacaggcatcgacaggacggagccctgttctcgcctaa

DBGET integrated database retrieval system