KEGG   Brachypodium distachyon: 100836085Help
Entry
100836085         CDS       T01717                                 

Definition
(RefSeq) uncharacterized protein LOC100836085
  KO
K03505  DNA polymerase delta subunit 4
Organism
bdi  Brachypodium distachyon
Pathway
bdi00230  Purine metabolism
bdi00240  Pyrimidine metabolism
bdi01100  Metabolic pathways
bdi03030  DNA replication
bdi03410  Base excision repair
bdi03420  Nucleotide excision repair
bdi03430  Mismatch repair
bdi03440  Homologous recombination
Module
bdi_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100836085
   00240 Pyrimidine metabolism
    100836085
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100836085
   03410 Base excision repair
    100836085
   03420 Nucleotide excision repair
    100836085
   03430 Mismatch repair
    100836085
   03440 Homologous recombination
    100836085
DNA replication proteins [BR:bdi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    100836085
DNA repair and recombination proteins [BR:bdi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100836085
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     100836085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 100836085
NCBI-ProteinID: XP_003578452
UniProt: I1IRX3
Position
4
AA seq 131 aa AA seqDB search
MASSGVKDFYRQKKKGGITKTSSCSKKKTQQYTGGASVGASNPAQTSALISHGSLDLKDD
ISEQEEQLRQFDMDMKFGPCIGVNRLQRWERASAMGLQPPSHLRDLLAHSASMNNHNNGS
PSPECLWEGKI
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcttctagtggtgtgaaagatttctaccggcagaaaaagaaaggtggtataaccaaa
acttcatcatgttctaagaagaaaacacagcagtacactggaggggcctccgttggcgct
tcgaatcctgctcagacatcagcactaatttctcatggatccttagatctcaaagatgat
atcagtgagcaggaggagcagttgcggcagtttgacatggacatgaagttcggcccatgt
attggtgtcaatcggcttcagcgttgggagcgcgcttctgccatgggcctccagccacca
tctcatcttcgggacctcttggcacacagcgcttccatgaacaatcacaataatggtagc
ccctcccctgagtgcctatgggagggtaaaatctag

DBGET integrated database retrieval system