KEGG   Brachypodium distachyon: 100836644Help
Entry
100836644         CDS       T01717                                 

Definition
SNF1-related protein kinase catalytic subunit alpha KIN10-like
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
bdi  Brachypodium distachyon
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:bdi04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 502 aa AA seqDB search
MEGGGKDGNPLKNYRIGKTLGIGSFGKVKIAEHIKTGHKVAIKILNRRKIKSMEMEEKVK
REIKILRLFMHPHIIRLYEVIDAPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQ
IISGVQYCHRNMVVHRDLKPENLLLDNNCDVKIADFGLSNVMRDGHFLKTSCGSPNYAAP
EVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSGSAR
DLIPRMLVVDPMKRITIREIREHPWFVAQLPRYLAVPPPDTAQQVKKIDEETLGKVISLG
FDKNLLVESIHNRLQNEATVAYYLFLDNKHRTTSGYLGAEYQEAMDSSFSPITPSETQSS
AHGNRQQLYMESPVGLRPHFPAERKWALGLQSRANPREVMTEVLKALQELNVYWKKIGHY
NMKCRWSPGFPSQENMNHANYNFSVEPIGTDDLGDKLNLIKFEIQLYKTRDEKYLLDLQR
ASGPHLLFLDLCAAFLAQLRVL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggagggcggcggcaaagatggcaaccctttgaagaactatcgtattggcaagaccctg
gggattggttcgttcgggaaggtgaagattgccgagcatataaaaactggccacaaggtg
gcgatcaagatccttaaccgtcggaaaatcaaaagcatggagatggaagagaaagttaaa
agagagatcaagatattaaggctattcatgcacccgcatatcatccgtctttatgaagtg
atagatgcaccagctgatatttatgtggttatggagtatgttaagtcaggtgaactattt
gattacattgttgagaaaggtaggctacaagaggaagaggcccgccgcttttttcaacag
atcatatcgggtgttcaatattgccaccgaaacatggtggtgcatcgtgatttaaagcca
gagaaccttctgttggataataactgcgatgttaagattgcagactttggcttaagtaat
gttatgcgtgacggccactttctgaagacaagctgcggcagcccaaattatgcagcacct
gaggtcatatctggtaaactgtatgctggacctgaagttgatgtctggagctgtggtgtt
attctttatgctcttctatgtggtactcttccatttgatgacgagaacataccaaacctt
tttaagaaaataaagggtggaatatatacccttccgagccatttatcaggttcagcaagg
gatttgattccaagaatgctggttgttgatcctatgaaaagaattaccattcgtgaaatc
cgtgagcatccatggtttgtagctcaactcccacgctatttggctgtgcctcctccagat
actgcacaacaagttaaaaagattgatgaagaaactcttggtaaagtcatcagtctagga
tttgataagaaccttttggtggagtcaattcataatagattgcaaaatgaggcaacagtt
gcatattatttatttttggataataagcatcgaacaacaagtggttatcttggggctgag
tatcaagaagctatggactcttcattctcacccataactccaagcgaaacacaaagttcg
gcacatggaaatcggcaacaattatatatggaatctccagttggcttgaggccacatttt
ccagccgagaggaaatgggctcttgggcttcagtctcgagctaatccaagagaagtaatg
actgaagtgctcaaggctctgcaagaactgaatgtgtattggaaaaaaattggacactac
aacatgaaatgtagatggagtcctggctttcctagtcaagagaatatgaatcatgccaat
tataacttcagtgtagaacctattggaaccgatgacctgggtgacaagttaaatttaatt
aagtttgaaattcagctttacaaaaccagagatgaaaaatatctactcgatttgcaaagg
gccagtggtccacatctgctctttcttgatctatgtgctgcctttctagctcagctgaga
gtcctttga

DBGET integrated database retrieval system