KEGG   Brachypodium distachyon: 100836922Help
Entry
100836922         CDS       T01717                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
bdi  Brachypodium distachyon
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bdi00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 263 aa AA seqDB search
MSSLVRVLFSLAAAIAAASLLAATLRRRAQQPGLPDQLVPGPMAARNRSFVLWLHGLGDS
GPANEPIRTFFSAPEFRLTKWAFPSAPNSPVSCNQGAVMPSWFDIHELPMSPGSPQDESG
VLKAVENVHAMIDREVAGGIHPDNIFVCGFSQGGALTLASVLLYPKTLGGGAVFSGWVPF
GSSVIERISPEARKTPIMWSHGMADRVVLFEAGQAGPPFLQSAGVSCEFKAYPDLGHSIA
KEELSALESWIKGHLNASQDKES
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcctggtccgcgtcctcttctccctcgccgccgccatcgccgcggcctccctg
ctcgccgccaccctccgccgccgcgcgcagcagccaggcctccccgaccagctcgttccg
ggtcccatggcggcccgcaaccggagcttcgtgctgtggctgcacggcctcggcgactcc
ggccccgccaacgagcccatccgcaccttcttctccgcgccggagttccgcctcaccaag
tgggcgttcccctccgcgcccaactcccccgtttcctgcaaccaaggcgccgtgatgccg
tcatggttcgatattcatgagctacccatgagccctggttcgccgcaagacgagagtggt
gttcttaaggctgtggaaaatgtgcacgccatgatcgacagggaggtagccggcgggatc
catcctgacaacatatttgtttgtgggttcagtcaaggaggtgcactgacattagctagc
gttttgctctatccgaagacgctaggtggtggcgccgtgttcagtggctgggtgcctttc
ggttcgtcagtcattgagaggatttctcccgaagcgaggaagacacctatcatgtggtca
catggaatggctgacagagtggtattatttgaagctggtcaagctggcccgccatttttg
caaagtgcaggggttagttgtgaatttaaggcatatccagatcttggtcactcgattgcg
aaggaagagctaagcgctctcgagtcttggatcaagggtcatctaaacgcctcccaggat
aaggaaagttaa

DBGET integrated database retrieval system