KEGG   Brachypodium distachyon: 100836922Help
Entry
100836922         CDS       T01717                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
bdi  Brachypodium distachyon
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100836922
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100836922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 263 aa AA seqDB search
MSSLVRVLFSLAAAIAAASLLAATLRRRAQQPGLPDQLVPGPMAARNRSFVLWLHGLGDS
GPANEPIRTFFSAPEFRLTKWAFPSAPNSPVSCNQGAVMPSWFDIHELPMSPGSPQDESG
VLKAVENVHAMIDREVAGGIHPDNIFVCGFSQGGALTLASVLLYPKTLGGGAVFSGWVPF
GSSVIERISPEARKTPIMWSHGMADRVVLFEAGQAGPPFLQSAGVSCEFKAYPDLGHSIA
KEELSALESWIKGHLNASQDKES
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcctggtccgcgtcctcttctccctcgccgccgccatcgccgcggcctccctg
ctcgccgccaccctccgccgccgcgcgcagcagccaggcctccccgaccagctcgttccg
ggtcccatggcggcccgcaaccggagcttcgtgctgtggctgcacggcctcggcgactcc
ggccccgccaacgagcccatccgcaccttcttctccgcgccggagttccgcctcaccaag
tgggcgttcccctccgcgcccaactcccccgtttcctgcaaccaaggcgccgtgatgccg
tcatggttcgatattcatgagctacccatgagccctggttcgccgcaagacgagagtggt
gttcttaaggctgtggaaaatgtgcacgccatgatcgacagggaggtagccggcgggatc
catcctgacaacatatttgtttgtgggttcagtcaaggaggtgcactgacattagctagc
gttttgctctatccgaagacgctaggtggtggcgccgtgttcagtggctgggtgcctttc
ggttcgtcagtcattgagaggatttctcccgaagcgaggaagacacctatcatgtggtca
catggaatggctgacagagtggtattatttgaagctggtcaagctggcccgccatttttg
caaagtgcaggggttagttgtgaatttaaggcatatccagatcttggtcactcgattgcg
aaggaagagctaagcgctctcgagtcttggatcaagggtcatctaaacgcctcccaggat
aaggaaagttaa

DBGET integrated database retrieval system