KEGG   Brachypodium distachyon: 100837028Help
Entry
100837028         CDS       T01717                                 

Definition
(RefSeq) replication protein A 32 kDa subunit C-like
Organism
bdi  Brachypodium distachyon
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 399 aa AA seqDB search
MATAASYFSGTAVMPRAGPAAAADYTAGAGTPPPSKSHNPRYSGCVPATVLHIARSFAAA
AAADDGGGDPVFSIDGVETSNVRVLGRVLNIVSRETDVSFTLDDGTGKIALVRWITDQLD
ARDTAYIRDGVYVRVHANVTGFQAKQQAFIRSIRPVTNFNEVVLHYIECMHVHMENTRIK
MQGQLPPAVQTNAYTHEPGGVREHQVHFTPQVQQGQLPPAVRTNTSTYVPYSGSVREHQV
HFTPQVNQVHLPSAVRADTSTYVPFTGGMRENQAHFTQVNQGQFLPPVQTNASTHGPFSG
RQREHPVHSAPQVNQFSSYSATSGQQYDLQSMVLGVLQAPDIISLENGIHIDEVARRTGA
PKTNIMEVINFLADTGLLCWTIDDYHVKCTADQRSNLRN
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgcctcctacttctccggcacggccgtcatgccgcgtgcggggcccgcc
gccgccgccgactacaccgccggcgcaggcacccctccaccctctaagtcgcacaacccc
cgctactccggctgcgtccccgccaccgtactccacatcgcccgctccttcgccgccgcg
gccgccgccgacgacggcggcggcgaccccgttttctccatcgacggcgtcgagaccagc
aacgttagggttttggggagggttttaaacattgtgagcagggagactgacgtgtcattc
acgctcgatgacggtactgggaagatcgccctcgtgcggtggatcactgaccagctagat
gctcgtgacacggcttatatccgggatggcgtgtacgtcagggttcatgcaaatgtcaca
gggtttcaagctaagcagcaggcgtttatccgatctatcaggccggttaccaatttcaat
gaagtggtgctgcattacattgaatgcatgcatgtgcacatggaaaatactcggataaag
atgcaagggcaactcccgcctgcagttcaaacaaacgcatatacacatgagcctggtgga
gtgagagaacaccaagtacattttactcctcaagtacaacaaggacaactcccgcctgca
gttcgaacaaacacatctacttatgtgccttattctggtagtgtgagagaacaccaagtc
cattttactcctcaagtaaaccaagtgcacctaccgtctgcagttcgagcagacacatct
acttatgtgccttttactggtggcatgagagaaaatcaagctcatttcactcaagtaaat
caaggacaattccttcccccagttcaaacaaatgcatctactcatggacctttttctggc
agacagagagaacatccagttcattctgctcctcaagtaaaccaattttcatcttactca
gccaccagtggacaacagtatgacctgcaaagtatggttttgggagttctacaagcacct
gatattatatcccttgaaaatggtatacacattgacgaagtggctagaagaactggagcg
ccaaaaacaaatattatggaggttatcaactttctcgctgatacaggcttgctctgttgg
accattgatgactatcatgtcaagtgtacggctgatcaacgcagtaatcttcggaactag

DBGET integrated database retrieval system