KEGG   Brachypodium distachyon: 100837028Help
Entry
100837028         CDS       T01717                                 

Definition
uncharacterized LOC100837028
Orthology
K10739  
replication factor A2
Organism
bdi  Brachypodium distachyon
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:bdi03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bdi03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bdi03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bdi03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 431 aa AA seqDB search
MATAASYFSGTAVMPRAGPAAAADYTAGAGTPPPSKSHNPRYSGCVPATVLHIARSFAAA
AAADDGGGDPVFSIDGVETSNVRVLGRVLNIVSRETDVSFTLDDGTGKIALVRWITDQLD
ARDTAYIRDGVYVRVHANVTGFQAKQQAFIRSIRPVTNFNEVVLHYIECMHVHMENTRIK
MQGQLPPAVQTNAYTHEPGGVREHQVHFTPQVQQGQLPPAVRTNTSTYVPYSGSVREHQV
HFTPQVNQVHLPSAVRADTSTYVPFTGGMRENQAHFTQVNQGQFLPPVQTNASTHGPFSG
RQREHPVHSAPQVNQFSSYSATSGQQYDLQSMVLGVLQAPDIISLENGIHIDEVARRTGA
PKTNIMYTSIFLFSPVAWRLSTFSLIQACSVGPLMTIMSSVRLINAISFWNLAFSNYTDK
MAGLMNHKQIR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgcctcctacttctccggcacggccgtcatgccgcgtgcggggcccgcc
gccgccgccgactacaccgccggcgcaggcacccctccaccctctaagtcgcacaacccc
cgctactccggctgcgtccccgccaccgtactccacatcgcccgctccttcgccgccgcg
gccgccgccgacgacggcggcggcgaccccgttttctccatcgacggcgtcgagaccagc
aacgttagggttttggggagggttttaaacattgtgagcagggagactgacgtgtcattc
acgctcgatgacggtactgggaagatcgccctcgtgcggtggatcactgaccagctagat
gctcgtgacacggcttatatccgggatggcgtgtacgtcagggttcatgcaaatgtcaca
gggtttcaagctaagcagcaggcgtttatccgatctatcaggccggttaccaatttcaat
gaagtggtgctgcattacattgaatgcatgcatgtgcacatggaaaatactcggataaag
atgcaagggcaactcccgcctgcagttcaaacaaacgcatatacacatgagcctggtgga
gtgagagaacaccaagtacattttactcctcaagtacaacaaggacaactcccgcctgca
gttcgaacaaacacatctacttatgtgccttattctggtagtgtgagagaacaccaagtc
cattttactcctcaagtaaaccaagtgcacctaccgtctgcagttcgagcagacacatct
acttatgtgccttttactggtggcatgagagaaaatcaagctcatttcactcaagtaaat
caaggacaattccttcccccagttcaaacaaatgcatctactcatggacctttttctggc
agacagagagaacatccagttcattctgctcctcaagtaaaccaattttcatcttactca
gccaccagtggacaacagtatgacctgcaaagtatggttttgggagttctacaagcacct
gatattatatcccttgaaaatggtatacacattgacgaagtggctagaagaactggagcg
ccaaaaacaaatattatgtatacctctatctttcttttttctcctgttgcgtggaggtta
tcaactttctcgctgatacaggcttgctctgttggaccattgatgactatcatgtcaagt
gtacggctgatcaacgcaatatccttctggaatctggcattctcaaactacactgacaaa
atggctggactgatgaaccataagcaaattaggtaa

DBGET integrated database retrieval system