KEGG   Brachypodium distachyon: 100837420Help
Entry
100837420         CDS       T01717                                 

Gene name
MPK3
Definition
mitogen-activated protein kinase 5-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 369 aa AA seqDB search
MDGAPVAEFRPTMTHGGRFLLYNIFGNQFEITAKYQPPIMPIGRGAYGIVCSVMNFETRE
MVAIKKIANAFDNNMDAKRTLREIKLLRHLDHENIVGLRDVIPPAIPQSFNDVYIATELM
DTDLHHIIRSNQELSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLLLNANCDLKICD
FGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRAPLFPGR
DHMHQMRLITEVIGTPTDDDLGFIRNEDARRYMRHLPQFPRRPFPAQFPRVQPAALDLIE
RMLAFNPLQRITVEEALEHPYLERLHDIADEPICTDPFSFDFEQHPLTEDQMKQLIFNEA
LELNPNFRY
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgctccggtggccgagttccggccgacgatgacgcacggcggcaggttcctc
ctgtacaacatattcggcaaccagttcgagatcacggccaagtaccagccgcccatcatg
cccatcggccgtggcgcctacgggatcgtctgctcggtgatgaactttgagaccagggag
atggtggcaatcaagaagatcgcaaacgcgttcgacaacaacatggatgccaagcgcacg
ctccgggagatcaagctcctcaggcacctcgaccacgagaacatcgttggcctgagagac
gtgatcccgccggcgatcccgcagtcgttcaacgacgtgtacatcgccacggagctcatg
gacacggacctccaccacatcatccgctccaaccaggagctctcagaagagcactgccag
tactttctgtaccagctgctgcgggggctcaagtacatccactcggcgaacgtgatccac
cgggacctgaagcccagcaacctgctgctgaacgccaactgcgacctcaagatctgcgac
ttcggcctcgcgcggccgtcgtcggagagcgacatgatgacggagtacgtggtgacgcgg
tggtacagggcgcccgagctgctgctcaactccaccgactactccgccgccatcgacgtc
tggtccgtcggctgcatcttcatggagctcatcaaccgggcgccgctcttcccggggaga
gaccacatgcaccagatgcggctcatcaccgaggtcatcgggaccccgaccgacgacgac
ctggggttcatccggaacgaggacgccaggaggtacatgaggcacctgccgcagttcccc
cgccgccccttcccggcccagttcccccgggtgcagcccgccgcgctcgacctcatagag
cggatgctcgccttcaatcccctccagaggatcacagtggaagaagcgctggagcatccg
tacctggagcggctgcacgacatcgcggacgagcccatctgcacggacccgttctccttc
gacttcgagcagcaccctttgacggaagaccagatgaagcagctgatattcaacgaggcc
ctcgaactgaaccccaacttccgatactag

DBGET integrated database retrieval system