KEGG   Brachypodium distachyon: 100837729Help
Entry
100837729         CDS       T01717                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
bdi  Brachypodium distachyon
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100837729
   00500 Starch and sucrose metabolism
    100837729
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100837729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1
AA seq 517 aa AA seqDB search
MHWINDPNGVMYYKGVYHLFYQYNPKAAVWGNIVWAHAVSTDLVNWVMLEPAIYPTAPFD
VNGCWSGSATVLPDGRPAIMYTGIDGDGRQVQNVAYPKDLSDPYLREWVKPDYNPVIPPG
SGVNATAFRDPTTAWLGPDGLWRLVVGTKDNHRGLAVLYRSRDFQSWAPAEGGPLHHGDT
GMWECPDFYPVGDGAQTKHVLKVSLDLTRFEYYTFGSYDHANDTYVPDAALADGERGLRY
DYGNFYASKTFLDTANKPRRVLWGWANESDSTADDVRKGWAGVQAIPRKLWLAPDGKQLM
QWPVAEVESLRGNHVNITDRLVEAGSYFEVQGLMIPAQADVEVSFAVVGGLDKAEPFDPA
WRGADAQTVCAARGADAEGGVGPFGLWVLASDQLKERTAVFFRVFNDDGKHVVLMCNDPS
RSSYADHLYKPTFAGFIDVDLAKTGGKIPLRTLIDHSMVESFGGHGKMSILSRVYPTQAV
GDKARLYVFNNGETDVKVTHLNAYDMRSAKISTEIDR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcactggatcaacgatcctaatggcgtgatgtactacaagggcgtgtaccacctgttc
taccagtacaaccccaaggcggcggtgtggggcaacatcgtgtgggcgcacgccgtgtcg
acggacctcgtgaactgggtcatgctggagccggccatctacccgacggcgcccttcgac
gtcaacggctgctggtcgggctccgccaccgtgctccccgacggccggcccgccatcatg
tacaccggcatcgacggcgacggccggcaggtgcagaacgtcgcgtacccgaaggacctc
tccgacccttacctccgtgagtgggtcaagccggactacaaccccgtcatcccccctggc
tccggggtgaacgccaccgcgttccgcgacccgaccacggcgtggctgggccccgacggg
ctctggcgcctcgtggtcggcaccaaggacaaccaccgcggcctcgccgtgctctaccgc
agccgggacttccagagctgggcgcccgcagagggtggccctctgcaccacggcgacacc
ggcatgtgggagtgcccggacttctaccccgtcggcgacggcgcccagaccaagcacgtg
ctcaaggtgagcctcgacctgacgcggttcgagtactacacgttcggctcctacgaccac
gccaatgacacgtacgtccctgacgcggcgctggccgacggggaacgcgggctccggtac
gactacggcaacttctacgcgtccaagacgttcctcgacacggcgaataagccgcggcgc
gtgctgtggggctgggccaacgagtccgactccacggccgacgacgtcaggaagggctgg
gccggcgtgcaggccatcccgaggaagctctggctcgcgccggacggcaagcagctcatg
cagtggcccgtggccgaggtcgagtccctccggggcaaccacgtcaacatcaccgacagg
ctcgtggaggccgggagttacttcgaggtccaggggctcatgatcccggcgcaggcggac
gtggaggtgtcgttcgcggtggttggcgggctggacaaggccgagccgttcgacccggcg
tggcgcggggccgacgcgcagacggtgtgcgcggcgcggggcgcggacgcggagggcggc
gtcggcccgttcgggctgtgggtgctcgcgtccgaccagctcaaggagaggacggccgtc
ttcttcagggtattcaacgacgacggcaagcacgtcgtgctcatgtgcaacgacccttcc
aggtcgtcatacgccgaccacctctacaagcccacttttgccggcttcatcgacgtcgac
ctcgccaagaccggcggcaagattcctctcagaaccttgatcgaccactccatggtggag
agcttcggaggccacggcaagatgagcatcctgtcccgtgtgtacccgacgcaggccgtc
ggagacaaggcgcgcctctacgtgttcaacaacggcgagacggacgtcaaggtcacgcac
ctcaatgcctacgacatgcgctcggccaagatcagcacggagatcgatcgatga

DBGET integrated database retrieval system