KEGG   Brachypodium distachyon: 100837759Help
Entry
100837759         CDS       T01717                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2-like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bdi  Brachypodium distachyon
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bdi00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 198 aa AA seqDB search
MEHEFQDGKEEVIQAWYMDDSEEDQRLPHHREPKEFIPLDKLSELGVVSWRLNADDWEKD
ENLKKIREARGYSYVDICDVCPEKLPNYEAKLKNFFEEHLHTDEEIRYCLEGSGYFDVRD
QDEQWIRIAVKKGGMIVLPAGMYHRFTLDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARK
EYFSKIINRGGNQTVEAR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggagcacgagttccaggatggcaaggaggaggtcatccaagcgtggtacatggatgac
agtgaagaagaccagaggcttcctcatcaccgtgagccgaaagagttcattcctctcgac
aaactttcagagttaggagtagtaagctggcggctaaatgctgatgactgggaaaaagat
gagaacctcaagaaaatccgtgaggccaggggatactcttacgtggacatttgcgacgtg
tgtccagagaagttgccaaactatgaggccaaactgaagaatttctttgaagagcacttg
catacagacgaagagatacgctattgtcttgagggcagtggatactttgatgtgagggac
caagatgagcagtggatccgtatagcagtgaagaaagggggcatgattgttttgcctgca
ggaatgtatcaccgctttacgttagatagtgacaactacatcaaggcaatgcggctcttt
gtgggagagcctgtctggactccgtacaatcgtcctcatgaccatctcccagctagaaag
gagtatttttccaaaattatcaacagaggtgggaatcaaactgttgaagctcgttga

DBGET integrated database retrieval system