KEGG   Brachypodium distachyon: 100837941Help
Entry
100837941         CDS       T01717                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
bdi  Brachypodium distachyon
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100837941
Exosome [BR:bdi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100837941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1710 aa AA seqDB search
MAAANAPIAMREALTLTSLGIAPQFVTFTHVTMESDRYICVRETSPQNSVVIVDMAMPSQ
PLRRPITADSALMNPNTRILALKAQIAGTTQDHLQIFNIEAKTKVKSHQMPEQVVFWKWI
TPKLLGLVTQTSVYHWSIEGDSEPTKMFDRTANLANNQIINYRCDPAEKWLVLIGIAPGA
PERPQLVKGNMQLFSVDQQRSQALEAHAASFATFKVAGNENPSTLICFASKSSNAGQITS
KLHIIELGAQPGKPGFSKKQADLFFPPDFQDDFPVAMQISQKYGLVYVITKLGLLFVYDL
ETAAAVYRNRISPDPIFLTAESSTTGGFYAINRRGQVLHATVNDATVVPFVSGQLNNLEL
AVNLAKRANLPGAENLVVQRFQELFAQTKYKEAAELAAESPQGILRTPETVAKFQSVPVQ
AGQTPPLLQYFGTLLTKGKLNAYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILRTDPQ
GAVNFALMMSQMEGGCPLDYNTITDLFLQRNMIREATAFLLDVLKPNLPEHAFLQTKVLE
INLVTYPNVADAILANGMFSHYDRPRIAQLCEKAGLYLRALQHYAELPDIKRVIVNTHAI
EPQALVEFFGTLSKEWALECMKDLLLVNLRGNLQIVVQAAKEYSEQLGVDACIKLFEQFK
SYEGLYFFLGSYLSSSEDPDIHFKYIESAARTGQIKEVERVTRESNFYDAEKTKNFLMEA
KLPDARPLINVCDRFGFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE
DFIKGLILSVRSLLPVEPLVDECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDS
NNNPEHFLTTNPFYDSRVVGKYCEKRDPTLAVVAYRRGQCDEELINVTNKNSLFKLQARY
VVERMDGDLWDKVLQPENEYRRQFIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIE
LLEKIVLQNSAFSGNFNLQNLLILTAIKADSSRVMDYVNRLDNFDGPAVGEVAVEAQLYE
EAFSIFKKFNLNVQAVNVLLDNIQSIERAEEFAFRVEEDAVWSQVAKAQLREGLVSEAIE
SFIRADDAAHFLDVIRAAEEANVYDDLVKYLLMVRQKSREPKVDGELIFAYAKTDRLSDI
EEFILMPNVANLQNVGDRLYDEELYEAAKIIYAFISNWAKLAVTLVKLKQFQSAVDAARK
ANSAKTWKEVCFACVDAEEFRLAQICGLNIIVQVDDLEEVSEYYQNRGCFHELISLMESG
LGLERAHMGIFTELGVLYARYRPEKLMEHIKLFSTRLNIPKLIRACDEQQHWKELTYLYI
QYDEFDNAATTIMNHSPDAWDHMQFKDVCVKVANVEIYYKAVHFYLQEHPDLINDLLNVL
ALRLDHTRVVDIMRKAGQLHLVKPYMVAVQSNNVSAVNEALNELYVEEEDYERLRESVDM
HDNFDQIGLAQKLEKHELLEMRRIASYIYKKAGRWKQSIALSKKDNMYKDCMETCSQSGD
RELSEDLLVYFIEQGKKECFASCLFICYDLIRADVALELAWTNNMLDFAFPYLLQFIREY
TSKVDDLVKDRIESQKEEKAKEQEEKEVVAQQNMYAQLLPLALPAPPGMGGMGMPPMGGM
GMPPPMGGMGMPPMGPGPMPAYGMPPMGSY
NT seq 5133 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccaacgcgcccatcgccatgcgcgaggccctcacgctgacgagcctgggg
atcgcgccgcagttcgtcacattcacgcacgtcaccatggagtcggaccgctacatctgc
gtgcgggagacctcgccgcagaacagcgtcgtcatcgtcgacatggccatgcccagccag
ccgctccgcaggcccatcaccgccgactccgcgctcatgaacccaaacaccaggatcctc
gccctcaaagctcaaatagctggaacgacacaggatcacctgcaaatctttaatattgag
gcaaaaacgaaagttaagtcacaccagatgcctgaacaggttgtgttctggaaatggatt
acccctaagttgttgggtttggtaacacaaacatcagtttatcactggtcaattgaagga
gattctgaacccactaagatgttcgataggacagctaatctggccaataatcagattatc
aactatcgttgtgatccagcagagaagtggctcgtgcttattggaatcgcacctggtgct
ccagagaggccgcagctggtgaagggaaatatgcaacttttttctgtggatcagcagcgt
agccaagcacttgaagctcatgcagcttcttttgcaacattcaaggttgctggcaatgag
aacccatcaaccctcatctgttttgcttcaaagtcatcaaatgctggacagattacttct
aagttacatattattgaactaggtgcccagccagggaagcctggcttttccaagaaacaa
gccgatctcttcttcccaccagatttccaggatgattttcctgtagccatgcagatctct
caaaagtatggtcttgtctatgtaattacgaaacttgggcttttgtttgtttacgactta
gaaactgctgcagcagtttatagaaatagaatcagtcccgatcccatattcttgacggca
gagtcttctacaactggtggattttatgccatcaacagacgtgggcaggttttgcacgca
acagttaatgatgcaaccgttgtgccttttgtcagtggtcagttaaacaacctggagtta
gctgtcaatcttgccaaaagagccaatcttcccggggcagagaatctggttgtgcaaaga
tttcaggagctgttcgcacaaacaaaatacaaggaagcagcggagctggctgcagaatct
cctcagggtattctgagaactcctgagactgttgcaaaattccagagtgttcctgttcaa
gctgggcaaacacctccactcttgcagtactttggcacattacttacgaaagggaagctc
aacgcgtacgaatcacttgagttatctcgactcgttgtcaatcagaacaagaagaacctt
ttggaaaattggttggcggaagacaagttggagtgcagtgaagagctaggagatcttgtc
aagacggttgacaatgatcttgcactgaaaatatacataaaggctagggcaacccctaaa
gttgttgctgcttttgctgaaaggagggagttcgacaagatccttatatactcaaagcag
gttggatacacgcctgattacctcttcctactccagaccatattgcgcacggatccacag
ggagctgtcaactttgctctcatgatgtcacaaatggaggggggttgtccactagactat
aataccataactgatctcttccttcagagaaatatgatacgggaggcaactgcttttcta
ctggatgttctgaagccaaacttgccagagcatgcttttcttcagaccaaggttttggag
atcaacttggtgacttacccaaatgttgctgatgccatccttgctaatggcatgttcagt
cattatgatcgccctcgcattgctcaactgtgtgaaaaggctggcttgtacttgcgggcc
cttcagcactacgcagaattacctgatattaagcgtgtcatcgtgaatacccatgctatt
gagccacaggcacttgttgagttctttggaactctttctaaagaatgggcattagaatgc
atgaaggacctcctactggtcaatctgagaggaaatcttcaaattgttgtgcaggctgcc
aaagaatactctgagcagcttggggttgacgcttgcataaaactatttgagcaatttaaa
tcatatgagggcctctacttcttcctaggatcctatttaagctccagtgaggatccagac
atccatttcaaatacatagaatcagctgcaaggactggacaaattaaagaggttgagcgt
gtcaccagagagtccaacttttacgatgctgagaagacaaagaactttttgatggaagca
aaactgcctgacgcccgtccactgattaatgtttgcgaccgctttggttttgttcctgat
cttactcactatctgtacacaaataatatgctccggtatatcgaaggctatgtacagaaa
gtgaaccctggaaatgctccgttggttgtgggacagctacttgatgatgagtgcccggaa
gatttcattaagggtttgattttgtctgttcgctctctccttcctgtcgagccacttgtt
gatgaatgcgagaagaggaaccgcctacggttgctgacacaattcttggagcacttggtg
agcgagggtagccaagatgtgcatgtccacaatgcacttgggaaaattattattgacagc
aacaacaaccctgagcatttccttactaccaacccattctacgactctcgtgtggttggt
aaatactgtgaaaagcgggatcctacacttgctgttgttgcttacagacgtggacagtgt
gatgaagaactcatcaatgttaccaacaagaactccctgttcaagctgcaagctaggtat
gtagttgaaagaatggatggcgatctttgggacaaagttctacagcctgaaaatgaatat
agaaggcagttcattgaccaagtggtttctactgcattgcccgaaagcaagagtcctgag
caagtttctgctgccgttaaggctttcatgacagccgaccttcctcatgaactgatcgaa
cttcttgaaaagattgtccttcagaattctgcgttcagcggaaacttcaatcttcagaat
ctgctcatcttgacagccatcaaggcggactcgtccagggtcatggattatgttaacaga
ttggacaactttgatggtcctgctgttggagaagtagctgtagaagcacaactctacgag
gaggctttttccatattcaagaagttcaatttaaatgtgcaggctgtcaatgttctgttg
gataacatccaaagcattgaaagagcggaagagtttgcattccgtgttgaagaggatgct
gtttggagccaggttgccaaggcccagttgcgtgaaggtctagtcagtgaagcgattgag
tcctttattcgtgcagacgacgcggcacatttccttgatgtcatccgtgctgctgaggaa
gccaatgtatatgatgatttagtgaagtacttgctgatggtaaggcaaaagtcaagggag
cccaaagttgatggtgaactcatctttgcatatgctaaaactgataggctcagtgacatc
gaagagtttattcttatgccaaatgttgccaatctccaaaatgtcggtgatcgtctgtac
gacgaagaactttatgaagctgcaaagattatctatgccttcatctcgaactgggctaag
ctggctgtcaccttggtaaagctgaagcaattccaaagtgctgtagatgctgctcgtaag
gctaacagcgctaaaacatggaaggaggtctgctttgcttgtgttgatgctgaggagttc
cgtctagcgcaaatctgtggtctcaatattatagttcaggtcgatgacttggaagaagtg
agtgaatactaccagaacagaggatgtttccatgaacttatttccctcatggagagtggt
cttggacttgaacgagctcacatgggcatctttacagaattgggagttctgtatgctaga
tatcgccctgagaagctcatggaacacatcaaactcttctcaacacgtctcaacattcct
aagcttatccgtgcttgtgatgaacaacagcactggaaagagctcacatacctatacata
caatatgacgagtttgacaatgctgccaccactatcatgaaccattctccagatgcatgg
gatcatatgcaattcaaggatgtttgtgtcaaggttgcaaatgtcgagatatattacaag
gcagtgcacttctatttgcaagaacaccctgatctcatcaatgatcttctcaacgtgctt
gcacttcgtttggatcatacaagagttgttgatataatgcgcaaggctggtcagttgcat
cttgtgaaaccgtacatggttgcagttcagagcaacaatgtatctgctgtcaatgaagct
ttgaatgaactgtatgtcgaagaggaggactatgagaggctccgtgaatctgttgatatg
catgataactttgaccagataggtcttgcccagaagcttgagaagcatgaattgctcgag
atgaggaggattgcttcctacatatacaagaaggcgggcagatggaagcaatctattgcc
ctgtcaaagaaggataacatgtacaaggattgcatggagacatgctcacaatctggtgat
cgtgagctctcagaggatttgcttgtctattttatcgagcagggaaagaaggaatgtttt
gcttcttgcctcttcatttgctacgacttgattcgtgcagatgttgctcttgagcttgca
tggacgaataacatgctggactttgctttcccttatctgttacagttcatccgtgagtac
actagcaaggtagatgatttagtgaaggacaggattgaatcgcagaaggaagaaaaagct
aaagagcaagaagagaaggaagtagttgcacagcagaacatgtatgcccagttgctccct
ctcgccttgcccgctccacctggtatgggagggatgggcatgcctccgatgggtggaatg
ggcatgccgcctccaatgggcggaatgggcatgccaccgatgggtcctggtccgatgcca
gcatacgggatgcctccaatgggaagctactga

DBGET integrated database retrieval system