KEGG   Brachypodium distachyon: 100837970Help
Entry
100837970         CDS       T01717                                 

Definition
(RefSeq) histone H2B.1
  KO
K11252  histone H2B
Organism
bdi  Brachypodium distachyon
Brite
Chromosome and associated proteins [BR:bdi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100837970
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100837970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like RP-C TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 100837970
NCBI-ProteinID: XP_003564232
UniProt: I1H0K5
Position
1
AA seq 155 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPAVEKAEKAPAGKKPKAEKRLPAGKSAASSKEAGEGKKGKKK
AKKSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGESAKLARYNKKPTI
TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaggcagagaagaagccggcggcgaagaagcccgcggaggaggagcccgcc
gtggagaaggcggagaaggccccggcggggaagaagcccaaggccgagaagcggctgccg
gcgggcaagtctgccgcctcctccaaggaggccggcgaggggaagaaggggaagaagaag
gcgaagaagagcgtggagacctacaagatctacatcttcaaggtgctcaagcaggtgcac
ccggacatcggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatc
ttcgagaaactcgccggggagtccgccaagctcgcccgctacaacaagaagcccaccatc
acgtcccgcgagatccagacctccgtccgcctcgtcctcccaggcgagctcgccaagcac
gccgtctccgagggcaccaaggctgtcaccaagtttacctcctcttag

DBGET integrated database retrieval system