KEGG   Brachypodium distachyon: 100838119Help
Entry
100838119         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase 8-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 882 aa AA seqDB search
MATAATAAAPASASASASTSGRDAPAAAPSAVCLVPFRWWAGVREEAAEEGGVRYAATPA
ASPSYYGLRLLHSFLQPDLVLRLDRGECRAAGGGGGRSYALVPADELSRALARQNSSLAL
HNKHSFAGDSAGAYPLVLRISVRETNILTIKISKKDNPVDNYKRANKMFNIDSQPVHVWD
FSGQTNLILMNEWNRSHQDYCHSEQENLLEVQVYAMSDSLTFKIGGTNMNVDMSYGSIGR
AGSMGLIGLENLGNTCFMNSSIQCLAHTTKLVDYFLGDYDRDINRTNPLGLNGELALAFG
ELLRSLWTNDRKQVAPHHFKAKIACFAPQFSGFNQHDSQELLAFLLDGLHEDLNHVKCKP
YEEAKDASGRPDEEVADEYWSNHLARNDSVIVDTCHGQYKSTLTCPTCSKTSVTFDPFMY
LSLPVPSMAKRAMTVTVFSTDGSREPFSYDVRVPKFGTLSDLVQVLSAACSLRDDETLLV
TEVYNNRIIRYLEEPSDSISLLRDGDKLAAYRLPKQYEKSSLVVFTHKYVAEHSGVSNVA
PQIKEFEAPLLASLPEIVSGLTLESIYLKLLYPLRFSKSISSITGCGSCNGDCAVDLMDA
TGDCAADLMDATPSDSDGNCQSAQSEDGPERSHCDANESEVMEEPSESNCGGTAISDKEA
HREQFEFYLTNGRDDVQHKRMEMNDLNLLETTPSRLHVDVHWQHSVARQYNTSMLNNLPE
IHKLELIPKGTEDSVALHGCLEAFLKEEPLGPEDMWYCPCCKKHQQAMKKLDLWRLPEVL
VIHLKRFSYTQFTRNKLETSVDFPISDLDLSPYIAAKHEQPNSHYHLYAISNHYGNMGGG
HYTASIYQEGKGWYKFDDECVTPIREDSIKTPAAYVLFYRRE
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgccaccgccgccgccccggcctccgcctccgcctccgcctccacctcc
ggccgcgacgcccccgccgccgccccctccgccgtctgcctcgtccccttcaggtggtgg
gcgggggtgagggaggaggcggcggaggagggcggagtgcggtacgccgccaccccggcg
gcctcgccctcctactacggcctcaggctcctgcacagcttcctgcagccggatctcgtc
ctgcgcctcgaccgcggggagtgccgcgccgccggaggaggcgggggacgtagctacgcg
ctcgtcccggccgacgagctctcccgcgcgctcgccaggcagaactctagtttggcattg
cataataaacattcgtttgctggagatagtgctggtgcttatcctttggtgcttagaata
tctgtgcgtgaaacaaacattttgactattaagatcagcaaaaaggacaatccagttgat
aactataagcgggcaaacaagatgtttaacattgattctcaaccagttcatgtttgggat
ttttcagggcagacaaacctaatattaatgaatgaatggaatagatcacatcaagactat
tgccattcagagcaagagaatcttctagaagttcaagtctatgcaatgtccgattcctta
acattcaagattggcgggaccaacatgaatgttgatatgtcatatgggagcattggaaga
gctggctctatggggttaattggattggaaaatcttgggaatacttgctttatgaacagt
tcaatccaatgtttggctcacacaacaaagcttgttgattatttccttggagattacgac
agagatataaatcgaacaaatccactaggactgaatggggaacttgctttggcatttgga
gaattgttgaggagtttatggactaacgatcgaaaacaagtggcaccacatcattttaag
gcaaaaattgcctgctttgctcctcagttcagtggctttaatcagcatgattcacaagag
cttcttgctttcttattggatggtctccatgaagatcttaatcacgtgaaatgcaaacca
tatgaagaagctaaggatgcaagtggccgtccagacgaagaagtagcagatgagtattgg
agcaaccatttagctcgaaatgactctgtaatagttgatacctgccatggacaatacaag
tctacattaacttgtcctacttgtagtaaaacatctgttacctttgacccatttatgtac
ttatctttgcctgtaccttccatggcaaagagggcaatgactgtgactgttttcagcact
gatggtagcagagagccattctcatatgacgtcagggtgccaaaatttggcactcttagt
gatcttgttcaggttttaagtgctgcttgttcacttcgagatgatgagaccctgctcgta
acagaggtctataataatcgcattatccgatacctggaggagccttcagattcaatttcg
ttgctgagagatggagataaattggcagcataccggctaccaaagcaatatgaaaaatcc
tcacttgtggtttttacacacaaatacgttgctgagcattctggtgttagtaacgttgct
ccacaaatcaaggaatttgaggctccgcttttggcatcacttcctgagatagtcagtgga
ttgactcttgagagtatctatctgaaattgttgtacccgcttcgattttccaagagcatt
agttcgatcactggttgtgggagttgcaatggtgactgtgctgttgacctgatggatgca
actggtgactgtgctgctgacttgatggatgcaacaccttcggattcagatggtaattgt
cagagtgcccagtcggaagatggccctgaaagaagccactgcgatgctaatgaatctgaa
gtgatggaagaacctagtgagtcaaattgtggaggaacagctatttctgataaggaggca
cacagggaacagtttgaattttatctaacaaatggaagggatgatgtccaacacaagagg
atggaaatgaatgatctgaatttacttgagacaacaccaagccggttgcatgtcgatgtc
cattggcaacatagtgtggcaagacaatataatacctcaatgctgaacaatctacccgag
atacataagcttgagcttatcccaaaaggaaccgaagattctgttgcactacatggttgt
ctagaagcctttctaaaagaggaaccattggggccagaggacatgtggtactgcccttgc
tgcaaaaagcatcagcaagcgatgaagaaattagatctctggaggctgcctgaagttctg
gtcatccatctgaaaaggttctcatacacccagttcacaagaaacaagcttgagacatct
gtagatttccccattagtgatttggacttgtcaccatatatcgccgccaagcatgaacag
ccaaacagccattatcacttgtacgccattagcaaccactatggaaatatgggaggtgga
cattacacagcaagcatctaccaagaagggaagggatggtacaaatttgatgatgaatgt
gtaacacctataagggaggacagcataaaaacaccagctgcttacgttctgttctacaga
cgagagtga

DBGET integrated database retrieval system