KEGG   Brachypodium distachyon: 100838412Help
Entry
100838412         CDS       T01717                                 

Definition
(RefSeq) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00260  Glycine, serine and threonine metabolism
bdi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01230  Biosynthesis of amino acids
Module
bdi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100838412
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100838412
Enzymes [BR:bdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100838412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth FMN_dh PcrB ThiG NanE BtpA TMP-TENI IGPS
Motif
Other DBs
NCBI-GeneID: 100838412
NCBI-ProteinID: XP_010228382
UniProt: I1GM77
Position
1
AA seq 275 aa AA seqDB search
MADPIVDGGNRSSVSETFSRLREQGKTAFIPFITAGDPDLATTSKALKILDSCGSDVIEL
GVPYSDPLADGPVIHAAATRALKKGTTLKAVLAMLKEVIPELSCPIVLFTYYNPILKLGV
RNFMTNIKQAGVHGLVVPDLPLEETTILRSEASMHSIELVLLTTPTTPTERMKEITKASA
GFVYLVSAVGVTGTRSNVNLHVEHLLQEIKQVTDKPVAVGFGISTPEQAKQIAGWGADGV
IIGSAIVRQLGEAASPEEGLKRIEDYAKSIKAAVP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccccatcgtggacggcggcaaccgcagcagcgtctcggagaccttctccagg
ctacgggagcagggcaagactgccttcatcccattcatcactgctggggaccctgatctg
gcaaccacgtcgaaagcgttgaagatcctcgattcctgtggttcggatgtgattgagctc
ggtgtaccttactcggatccattggctgatggtccggttatccatgccgcagcaacccgt
gcgcttaagaaaggcactacactcaaagctgtcttggcgatgctcaaggaggttatacct
gaactgtcttgtccaatagttctcttcacatactacaacccaattctaaagcttggggtg
cggaacttcatgacaaatattaaacaagctggtgtacatggtcttgtcgttcccgatctt
ccattggaagagacaacaatattgagaagcgaggcctctatgcacagcatagaactggtg
cttcttacaacaccaaccacgccaacagagaggatgaaggaaatcacaaaagcttcagca
ggatttgtttaccttgtgagtgctgttggagttacaggcacgcgctcaaacgtaaactta
cacgttgagcatcttcttcaggagatcaagcaggttacagacaaacctgtggctgttggc
tttggcatatcaactccagagcaagcgaagcagattgcaggctggggagcggatggtgtg
attatcggcagtgcaattgttagacagttgggagaagcggcttctcctgaagaagggctg
aaaagaatagaagattatgccaagagtattaaggctgctgtaccatga

DBGET integrated database retrieval system