KEGG   Brachypodium distachyon: 100838412Help
Entry
100838412         CDS       T01717                                 

Definition
indole-3-glycerol phosphate lyase, chloroplastic-like
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bdi  Brachypodium distachyon
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100838412
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100838412
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100838412
Enzymes [BR:bdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100838412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 275 aa AA seqDB search
MADPIVDGGNRSSVSETFSRLREQGKTAFIPFITAGDPDLATTSKALKILDSCGSDVIEL
GVPYSDPLADGPVIHAAATRALKKGTTLKAVLAMLKEVIPELSCPIVLFTYYNPILKLGV
RNFMTNIKQAGVHGLVVPDLPLEETTILRSEASMHSIELVLLTTPTTPTERMKEITKASA
GFVYLVSAVGVTGTRSNVNLHVEHLLQEIKQVTDKPVAVGFGISTPEQAKQIAGWGADGV
IIGSAIVRQLGEAASPEEGLKRIEDYAKSIKAAVP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccccatcgtggacggcggcaaccgcagcagcgtctcggagaccttctccagg
ctacgggagcagggcaagactgccttcatcccattcatcactgctggggaccctgatctg
gcaaccacgtcgaaagcgttgaagatcctcgattcctgtggttcggatgtgattgagctc
ggtgtaccttactcggatccattggctgatggtccggttatccatgccgcagcaacccgt
gcgcttaagaaaggcactacactcaaagctgtcttggcgatgctcaaggaggttatacct
gaactgtcttgtccaatagttctcttcacatactacaacccaattctaaagcttggggtg
cggaacttcatgacaaatattaaacaagctggtgtacatggtcttgtcgttcccgatctt
ccattggaagagacaacaatattgagaagcgaggcctctatgcacagcatagaactggtg
cttcttacaacaccaaccacgccaacagagaggatgaaggaaatcacaaaagcttcagca
ggatttgtttaccttgtgagtgctgttggagttacaggcacgcgctcaaacgtaaactta
cacgttgagcatcttcttcaggagatcaagcaggttacagacaaacctgtggctgttggc
tttggcatatcaactccagagcaagcgaagcagattgcaggctggggagcggatggtgtg
attatcggcagtgcaattgttagacagttgggagaagcggcttctcctgaagaagggctg
aaaagaatagaagattatgccaagagtattaaggctgctgtaccatga

DBGET integrated database retrieval system