KEGG   Brachypodium distachyon: 100838637Help
Entry
100838637         CDS       T01717                                 

Definition
protein disulfide isomerase-like 2-3-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
bdi  Brachypodium distachyon
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100838637
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100838637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 440 aa AA seqDB search
MHPAFLAALLLLFAAAASPAAALYSAGSPVLQLNPNNFKKVLNANGVVLVEFFAPWCGHC
KQLTPTWEKAAGVLKGVATIAALDADAHKELAQQYGIQGFPTIKVFIPGKPPVDYEGARD
VKPIVNFALQQVKSLLKDRLDGKTSGGSSGKTSGGSSEKKTDTNESIELNSSNFDELVIK
SKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDKSLMSKYKVEGFPTI
LVFGADKESPFPYQGARAASAIESFALEQLEANSAPPEVSELTSSDVMEEKCASAAICFV
SFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTGAGKQADLEKQVGVGGYGYPAM
VALNVKKGAYAPLRSAFQRDEIIEFVKEAGRGGKGNLPLDGAPTVVQSGPWDGKDGEVIE
EDEFSLEELMGDNSPPNDEL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcatccggccttcctcgccgccctcctcctcctcttcgccgccgcggcctccccggcc
gccgcactctactccgccggctccccggttctccagctcaatcccaacaacttcaaaaag
gtgctgaacgcgaacggggtggtgctggtggagttcttcgcgccgtggtgcgggcactgc
aagcagctgacgccgacgtgggagaaggccgctggcgtcctcaagggcgtcgccaccatc
gccgcgctcgacgctgacgcgcacaaggagctcgcgcagcaatatggaatacagggattc
ccaactataaaagtgtttatccctggtaagccaccagtggattatgaaggagcaagagat
gtaaagccaatagtaaattttgctctgcagcaggttaagtctcttcttaaagataggctg
gatggtaagacatcaggaggttcaagtggcaagacctctggtggttcaagtgagaagaaa
actgatactaatgaatcgatagaattgaattcaagtaactttgatgaacttgtcatcaaa
agcaaggacctttggattgtggagttctttgcaccgtggtgtgggcactgcaagaaattg
gcacctgaatggaaaagagctgcaaagaacttgaagggccaagtgaagctaggtcatgtt
gattgtgactctgataagtccttgatgagcaagtacaaggtagaaggctttccaaccatt
ctggtatttggggctgacaaggagagcccgttcccgtaccagggggccagagctgcatct
gccatcgaatccttcgcactggagcagttggaagccaactctgctccacctgaagtttct
gagttgactagctcagatgtcatggaagagaagtgtgcttctgctgccatttgctttgta
tctttccttccggacatcctagattcaaaggcagaaggaaggaacaagtaccttgagctg
ctcctttctgttgctgagaaattcaagaaaagtccatacagttttgtctggacaggtgct
ggcaagcaggctgatctggagaagcaggtgggggttggtggttacggctatccggccatg
gttgctctgaacgtgaagaaaggcgcatatgctccacttcgtagtgccttccagcgtgac
gaaattatcgagtttgtgaaggaggcggggcgcggtggaaagggaaaccttcctttggat
ggtgcccccacggttgtacagtccgggccatgggacggcaaagatggagaggtgatcgaa
gaggacgagttctcgcttgaggagctcatgggcgacaactctccaccgaatgacgagttg
tga

DBGET integrated database retrieval system