KEGG   Brachypodium distachyon: 100838983Help
Entry
100838983         CDS       T01717                                 

Definition
beta-hexosaminidase subunit B2-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bdi  Brachypodium distachyon
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bdi00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:bdi00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:bdi00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:bdi00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bdi00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 529 aa AA seqDB search
MPLSSLAEMALRLVLALALVGCAAAAAAGRVDLWPMPASVSSGAKTLYVAKDLKLSATGS
KYADGKAILAEAFKRMVAVVQMDHAVNGSYRGLPVLAGVNVVVRSPDDELKFGVDESYKL
SVPATGNPMYAQIEAQTVFGALHALETFSQLCYFDFVLRVTGLHSAPWTIMDMSRFPYRG
LLIDTARHYLPVPVIKSVIDSMTYSKLNVLHWHIVDEQSFPLEIPSYPKLSNGAYSYSEK
YTINDALDIVQYAEKRGVNVLAEIDVPGHARSWGVGYPSLWPSASCQQPLDVSNNFTFKV
IDGILSDFSKVFKFKFVHLGGDEVNTSCWTTTPRIKSWLVQHGMNESDAYRYFVLRAQKI
AISHGYDIINWEETFNNFGDKLDRKTVVHNWLGGGVAEKVVSAGLRCIVSNQDKWYLDHL
DATWEGFYMNEPLTNIYNPEQQKLILGGEVCMWGERIDASDIQQTIWPRAAAAAERLWTP
VEKLAKGATVVTARLARFRCLLNERGVAAAPLAGYGRTAPLEPGSCIRQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgagctctctcgcagagatggcgctgaggctggtgctggcgctcgcgttggtc
gggtgcgctgccgctgccgcggcagggcgcgtcgacctgtggccaatgccggcgtcggtg
agcagcggggccaagacgctctacgtcgccaaggacctcaagctgtcggcgacggggagc
aagtacgccgacgggaaggccatcctggcggaagccttcaagaggatggtggccgtcgtc
cagatggaccatgccgtcaatggcagttaccgcgggctccccgtgcttgccggtgtcaat
gtagttgtccgttccccggatgatgagctcaaattcggggtggatgaatcgtacaagctg
tcggtgcctgcaactgggaacccgatgtatgcccagattgaggcacaaacagttttcgga
gcgcttcatgctttggagacatttagccaactgtgttactttgattttgttttgagggta
actggacttcattcggctccttggacaatcatggacatgtcaagatttccttatcgaggg
cttcttattgatactgcaaggcattatctccctgtcccagtaatcaaaagtgtaatagat
tcaatgacctacagcaagttgaatgttcttcattggcatatcgtggacgagcagtcattt
cctcttgaaataccgtcatacccaaaactatcaaatggtgcatactcttattcagagaaa
tatacaatcaatgatgcgctcgatatcgtacaatatgctgaaaaacgaggtgtgaatgtc
ttggctgagattgatgtccctggccatgctcgctcatggggtgttgggtatccttcattg
tggccatcagctagctgccaacaaccgcttgatgtcagcaacaactttacttttaaagtg
atcgatggaattctgtcagattttagcaaggtttttaagttcaagtttgtccatttggga
ggtgacgaagtcaatacaagttgttggactacaacgccacgcattaaatcatggttggtt
caacatggtatgaatgagtctgatgcttacagatattttgtactaagagcccaaaagata
gcaatttcacatggctacgacattattaactgggaagaaacgttcaacaactttggagac
aagttggaccgcaaaactgtggtgcataactggcttggaggtggagttgcagagaaagtg
gtttctgctggtctgagatgcattgtaagcaaccaggataagtggtacctagatcatttg
gatgctacatgggaaggattttacatgaatgaaccattgacgaatatctacaacccagaa
caacagaagttgattcttggtggtgaggtatgcatgtggggtgagcgcatagatgcatct
gacattcagcaaaccatttggccacgtgctgcggcagctgcagagcggctgtggactcct
gttgagaagctcgcaaagggcgccacagtggtaactgcaagattggcacgcttcaggtgt
ttactgaatgaaagaggggtcgctgctgcacccctagctggatatggccgcacagcgcca
ttggagccaggatcctgtataaggcagtag

DBGET integrated database retrieval system