KEGG   Brachypodium distachyon: 100839224Help
Entry
100839224         CDS       T01717                                 

Gene name
MPK11
Definition
mitogen-activated protein kinase 2-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 387 aa AA seqDB search
MRMEGGGAGPAAAAAAGGAHGLGEAQIKGTLTHGGRYVQYNVYGNLFEVSAKYVPPIRPV
GRGACGIICAAINVQTREEVAIKKIGNAFDNQIDAKRTLREVKLLRHMNHENVISIKDII
RPPRRENFNDVYIVYELMDTDLHHLLRSNQPLTDDHCQYFLYQVLRGLKYVHSANVLHRD
LRPSNLLLNAKCDLKIGDFGLARTTTETDFMMEYVVTRWYRAPELLLNCSEYTGAIDMWS
VGCILGEIATREPLFPGKDYVHQLRLITELLGSPDDTSLGFLRSDNARRYVRSLPQYPKQ
QFRSRFPNMSSGAMDLLERMLVFDPNKRITVDEALCHPYLASLHEINDEPVCPAPFSFDF
EQPSFTEEDIKELIWRESVKFNPEPIH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatggaaggcggcggcgccgggccggcggcagcagcagcagcaggaggagcccat
ggcctcggcgaggcgcagatcaagggcacgctcacccacggcggcaggtacgtgcagtac
aacgtctacggcaacctcttcgaggtctccgccaagtacgtcccgcccatccgtcccgtc
ggccgcggcgcctgcggcatcatctgtgctgctatcaacgtgcagactcgcgaggaggtc
gccatcaagaagatcggcaacgcgttcgacaaccagatcgacgccaagcgcactttgcga
gaagtgaagctgcttcgacacatgaatcatgagaatgtgatttcaatcaaggacatcata
cgcccgccaaggcgggagaattttaacgatgtttacatcgtttacgagctgatggacact
gatcttcaccaccttcttagatcaaaccagccactcacagatgatcactgtcagtatttt
ctctaccaagtgctcagaggattaaagtatgtgcactcggcgaatgtcttgcaccgagac
cttaggccgagcaatctgttactgaatgccaaatgtgacctcaagattggggactttggg
ctggcgaggaccaccactgagactgacttcatgatggagtatgttgttacccggtggtat
cgggcgccagagctccttcttaactgctcggagtacaccggagctattgatatgtggtca
gtcggctgcatccttggtgagattgcaacaagagagcctctgtttcctggaaaagattac
gttcatcagctgaggctaattaccgagctgctaggctcaccagacgacaccagcctaggg
tttcttcggagcgataatgcccgcagatatgtcaggtctcttcctcaataccccaagcaa
caatttcgttcacggttcccaaatatgtccagtggcgccatggatttgcttgagaggatg
cttgtatttgatccaaacaagaggattactgttgacgaggctctgtgccatccctacttg
gcatcccttcatgagataaacgatgaacctgtctgcccagcgcctttcagctttgatttc
gagcagccatcatttaccgaggaagatatcaaagaactcatttggagggaatctgtcaag
ttcaaccctgaaccgattcactga

DBGET integrated database retrieval system