KEGG   Brachypodium distachyon: 100839250Help
Entry
100839250         CDS       T01717                                 

Definition
(RefSeq) chalcone--flavonone isomerase
  KO
K01859  chalcone isomerase [EC:5.5.1.6]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00941  Flavonoid biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Module
bdi_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100839250
Enzymes [BR:bdi01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     100839250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chalcone
Motif
Other DBs
NCBI-GeneID: 100839250
NCBI-ProteinID: XP_003559241
UniProt: I1GLL0
Position
1
AA seq 222 aa AA seqDB search
MAVSELEVDGVVFPPLERPPGSAHAHFLAGAGVRGMDIGGNFIKFTAIGVYLQADAAVSS
LAAKWAAKPAADLAADAAFFRDVVTGEFEKFTRVTMILPLTGAQYAEKVTENCVKYWQAT
GAYTDAEAAAVEKFREAFQPHSFAPGGSILFTHSPAGVLTVAFSKDSSVPASGAAAIENR
PLCEAVLESIIGEHGVSPAAKLSLATRVAELLKAAEPVSVSL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgtcggagcttgaggtcgacggcgtcgtcttcccgccgctcgagcggcccccg
ggctccgcccacgctcacttcctcgccggcgccggggtgcgagggatggacatcgggggc
aacttcatcaagttcacggccatcggcgtgtacctccaggccgacgccgccgtgtcctcg
ctcgccgccaagtgggccgccaagcccgccgccgacctcgccgccgacgccgccttcttc
cgcgacgtcgtcacaggcgagttcgagaagttcacgagggtgacgatgatcctgccgctg
acgggggcgcagtacgcggagaaggtgacggagaactgcgtcaagtactggcaggccacg
ggcgcgtacacggacgccgaggccgccgccgtggagaagttcagggaggcattccagccc
cacagcttcgctcccggcggctccatactcttcacccactcccccgccggcgtcctcacc
gtggcgttctcgaaggactcgtcggtgccggcgtcgggcgcggcggcgatagagaacagg
ccgctgtgcgaggccgtgctggagtccatcatcggcgagcacggggtctcgccggcggcc
aagctcagcctcgccaccagggtcgccgagctcctcaaggcggcagagcccgtgtccgtt
tcgttgtga

DBGET integrated database retrieval system