KEGG   Brachypodium distachyon: 100839381Help
Entry
100839381         CDS       T01717                                 

Definition
histone H2B.5-like
Orthology
K11252  
histone H2B
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 140 aa AA seqDB search
MAPKAEKKPAEKKPVEEKSAEKKPKAEKRVPGAAKEGGSEKKKKKAKKSVETYKIYIFKV
LKQVHPDIGISSKAMSIMNSFINDIFEKLAGESAKLARYNKKPTITSREIQTAVRLVLPG
ELAKHAVSEGTKAVTKFTSS
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggccgagaagaagcccgccgagaagaagccggtggaggagaagtcagcg
gagaagaagcccaaggcggagaaacgcgtgccgggcgccgccaaggagggcggctccgag
aagaagaagaagaaggccaagaagagcgtggagacctacaagatctacatcttcaaggtg
ctcaagcaggtgcacccggacattggtatctcctccaaggccatgtccatcatgaactcc
ttcatcaacgatatatttgagaagctcgccggcgagtcggccaagctcgcgcggtacaac
aagaagcccaccatcacctcccgggagatccagaccgcggtgcgcctcgtcctccccggc
gagcttgccaagcacgccgtctccgagggcaccaaggctgtcacaaagttcacgtcgtct
tag

DBGET integrated database retrieval system