KEGG   Brachypodium distachyon: 100839441Help
Entry
100839441         CDS       T01717                                 

Definition
indole-3-glycerol phosphate synthase, chloroplastic-like
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bdi  Brachypodium distachyon
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100839441
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100839441
Enzymes [BR:bdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     100839441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 380 aa AA seqDB search
MDSLLAASQLHPAPFSPAPSSARRSPPSVLVRGASRGGRAAVRCAAVTDSILYALQHDEM
FNSEEVIQWESGKSINTIAAAQGIRIRRRCRPRYPSEGSGDDKAVPRNILEQIVWDKEVE
VSQRKAKKPLKKVMESSEHAPPARDFIGALTAAYSRNGVPALIAEVKKASPSRGVLRDNF
HPVEIAQAYEQNGAACLSILTDEKHFQGSFENLETIRNSGVQCPLLCKEFVIDVWQIYYA
RSKGADAILLIAAVLPDLDMKYMLRVCRSLGMTALIEVHDERELDRVLKIDGVELIGINN
RSLETFEVDTSNTRMLLEKRGNVMREKGILVVGESGLFTPDDVAYVQSAGVSAVLVGESL
ITEEDPGRAIAELFGKELLR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggattctctcctcgccgcctcgcagctccatcccgcacccttctccccagcgccctcc
tccgcccgccggtcacctccgtccgtcctcgtccgcggtgccagcaggggtgggcgcgcc
gccgtccgatgcgccgccgtcacggactcgatcctctacgcgctgcagcatgacgagatg
ttcaactccgaggaggtgattcagtgggagagcggcaagtcgatcaacaccatcgccgcc
gcgcagggcatccgcatccgccgccgctgccgcccccgctacccctccgagggctccggc
gacgacaaggccgtaccccgcaacatcctcgagcagatcgtctgggacaaggaggtcgaa
gtgtcccagaggaaggccaagaagcctctgaagaaagtgatggagtccagcgagcatgcg
ccgcctgcgagggattttataggcgctctcacggcggcgtacagtcgaaacggcgtgccc
gccctcatcgccgaggttaagaaggcgtcgcccagcaggggcgtgctcagggacaacttc
catccggttgagatcgcgcaggcatacgagcagaatggcgcggcttgcctcagcatcctc
actgatgagaagcactttcaggggagctttgagaacctcgagacgatccgcaactccggt
gtgcagtgccctcttctgtgcaaggagttcgtcattgatgtctggcaaatctattacgct
cgatcaaaaggtgccgatgcaattctgttgattgctgctgtgctgcccgatcttgacatg
aagtacatgcttcgcgtctgcagaagtcttggaatgacagctcttattgaggttcatgac
gaaagagaactggatcgcgtgctgaaaatagatggcgttgagcttatcggcatcaacaac
cgcagtctagagacatttgaagtggatacttcaaacacgcggatgttgctggagaaacgt
ggtaatgtcatgagggagaaggggatactggttgttggcgaatctgggctgttcactccg
gatgatgttgcatatgtgcagagtgcaggcgtttccgcggtattggtaggagagtcccta
atcacggaagaagatcctgggcgagccatcgctgagctgttcgggaaagagctcttgcgc
tga

DBGET integrated database retrieval system