KEGG   Brachypodium distachyon: 100839462Help
Entry
100839462         CDS       T01717                                 

Definition
asparagine synthetase [glutamine-hydrolyzing]-like
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bdi  Brachypodium distachyon
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bdi00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 585 aa AA seqDB search
MCGILAVLGCADDTQGKRAHVLELSRRLKHRGPDWSGMHQVDDCYLSHQRLAIIDPASGD
QPLYNEDKSVAVTVNGEIYNHEELREQLSSHTFRTGSDCEVIAHLYEEHGENFVDMLDGV
FSFVLFDTRDRSFIAARDAIGVTPLYIGWGIDGSVWISSEMKGLNDDCEHFEIFPPGHLY
SSKKGGFKRWYNPPWFSEAIPSVPYDPLTLRKAFEKAVIKRLMTDVPFGVLLSGGLDSSL
VAAVAVRHLAGTKAAKRWGTKLHSFCVGLEGSPDLKAAREVADCLGTMHHEFHFSVQDGI
DAIEDVIYHTETYDVTTIRASTPMFLMSRKIKSLGVKMVISGEGSDEIFGGYLYFHKAPN
KEELHRETCHKIKALHQYDCLRANKATSAWGLEARVPFLDKEFINEAMSIDPEWKMIRPD
LGRIEKWVLRKAFDDEEQPFLPKHILYRQKEQFSDGVGYSWIDGLKAHAESNVTDKMMSN
AKFIYPHNTPTTKEAYYYRMIFERFFPQNSAILTVPGGPSVACSTAKAVEWDAQWSGNLD
PSGRAALGVHLSAYELEHLPATVAAVTSKKPRMLKAVAPGVAIES
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatactggcggtgctgggctgcgccgatgacacccaggggaagagggcacat
gtcctggagctctcgcgcaggctcaagcaccgcggccccgactggagcggcatgcaccag
gtcgacgactgctacctctcccaccagcgcctcgccatcatcgaccccgcctccggcgac
cagccgctctacaacgaagacaagtccgtcgctgtcaccgtgaacggggagatctataac
catgaagagctccgggagcagctctcttcccacaccttcaggaccggcagcgactgtgag
gtcatcgcacacctgtacgaggagcacggagagaatttcgttgacatgctggatggtgtc
ttctccttcgtcttgttcgacacacgcgatcgtagcttcatcgctgctcgtgacgctatt
ggtgtcacccccctgtacattggttggggaattgacgggtcggtgtggatatcatcagag
atgaaggggctaaacgatgattgcgagcattttgagatcttccctcctggccatctctac
tccagcaagaagggaggcttcaagagatggtacaaccctccttggttctccgaggccatt
ccttcagtgccctatgatccactcactctcaggaaggcatttgaaaaggcggtcatcaag
aggcttatgactgacgttccattcggtgttctgctctctggtggccttgactcgtcgttg
gtcgcagcagtcgcagttcgtcacttggcagggacaaaggctgcaaagcgctgggggact
aaactccactccttttgtgttggccttgagggatcacctgatttgaaggctgcaagggag
gttgctgactgcctgggcaccatgcaccatgagtttcacttcagtgttcaggatggcatt
gatgcaattgaagatgtgatatatcatactgaaacatatgatgtgacgacgatcagggca
agcacgccaatgtttctgatgtcacgcaagatcaagtcgcttggggtcaaaatggtcatc
tctggtgagggctcggatgagatcttcggagggtacctctacttccacaaggcccccaac
aaggaggagctccaccgtgaaacctgtcacaagatcaaagctctgcaccagtatgattgc
ttgagggccaacaaggcaacttctgcatggggccttgaagcacgtgttccgttcttggac
aaggagtttatcaatgaggcaatgagcatagatccagagtggaaaatgatccggcctgat
cttggaagaattgagaagtgggtgctgaggaaagcatttgatgacgaggagcagcctttc
ctgccaaagcatattctgtacaggcagaaagagcagttcagtgatggtgttggctatagc
tggattgatggcctaaaggctcacgcagaatcgaatgtgactgataagatgatgtcaaat
gcaaagttcatctacccacacaacaccccgacaacaaaagaagcctactattacaggatg
atctttgagaggttcttcccccagaactcggcgatcctgacggtgccaggcggaccaagc
gtggcatgcagcacagcgaaggcggtagaatgggatgctcagtggtctgggaacttggat
ccctcagggagagcagcacttggagtccatctctccgcctatgaactggagcatctccca
gccaccgttgctgcggtaaccagcaagaagccgaggatgctcaaggccgtggcacctggt
gtcgccattgagagctga

DBGET integrated database retrieval system