KEGG   Brachypodium distachyon: 100839490Help
Entry
100839490         CDS       T01717                                 

Definition
putative MYST-like histone acetyltransferase 1-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100839490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 435 aa AA seqDB search
MGSMELSTAPENGTAAACNGTAAPPNGGVERRLRSSSTSAAWGSHLPLEVGTRVMCRWRD
QKPHPVKVIERRKSSSYSSPADYEYYVHYTEFNRRLDEWVKLEQLDLETVEADVDEKVED
KATSLKMTRHQKRKIDETHVEQGHEELDAASLREHEEFTKVKNIAKIELGKYEIDTWYFS
PFPPEYNDSAKLFFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEIYRCGTLSMFEVDGKK
NKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYILCECDDRGCHMVGYFSKEKHSEESYNLA
CILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLEILKK
HKSNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHLKAAGRGGLD
VDVSKLIWTPYKEQG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgatggagttgtccaccgcgccggagaacggcaccgccgccgcgtgcaacggc
acggccgccccgcccaacggcggggtggagaggaggctgaggtcttcgtccacgtccgcg
gcgtggggttcgcatctgccgctggaggtgggcacgcgcgtgatgtgccggtggcgcgac
cagaagccccaccccgtcaaggtcatcgaacgccggaagtcatcctcctactcctcccca
gcggactacgagtactatgtccattacacggagttcaacaggaggcttgatgagtgggtc
aaacttgaacaacttgatcttgagactgtcgaggccgatgttgatgagaaggtagaagat
aaggcaacaagtttgaagatgacacgacaccagaagcgcaaaatcgatgaaacacacgtg
gagcaaggtcacgaggagcttgatgctgctagcttgcgggaacatgaggagttcacaaag
gtgaaaaatatagcgaagatagaacttgggaaatatgagatagatacctggtatttctct
cctttcccaccagagtacaatgactctgcaaagctgtttttctgcgagttttgcctgaac
ttcatgaagcgcaaagaacagctccagaggcatatgaagaagtgtgatcttaagcatcct
ccaggtgatgaaatctacagatgtggaactttatcgatgtttgaggttgatggcaagaag
aacaaggtttacggacagaacctatgctatctggccaagctatttctggatcacaaaaca
ctttactatgatgtggatttgttcttgttttatatcctatgtgaatgtgatgatcgagga
tgtcatatggtgggatatttctcgaaggagaagcactccgaggaatcttataatttggct
tgcattctcactctccctccatatcaaagaaaaggatatggaaaattcctgattgctttc
tcttatgagctttctaaaaaggaaggtaaagtggggacaccggagcgtcctctttcagat
cttggtctactcagttatagaggttattggactagagtgcttctggaaattttgaagaaa
cataagagcaacatatccattaaggagcttagcgacatgacggcgataaaagcggatgac
atcttgagcacgctgcagagtctggacttgatccagtaccggaaagggcagcacgttatc
tgtgcggatccaaaggtccttgaccgccacctcaaggctgcgggccggggaggcctcgac
gtggacgttagcaagctgatctggacaccgtacaaagaacaaggctaa

DBGET integrated database retrieval system