KEGG   Brachypodium distachyon: 100839535Help
Entry
100839535         CDS       T01717                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
bdi  Brachypodium distachyon
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100839535
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100839535
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100839535
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100839535
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100839535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 413 aa AA seqDB search
MPSLAAAAAARRAGEALRRGVMGGMRSLSSSTASPAPAAAAAAGPDSDEVIVEGKASARA
AVLNRPGHLNALTTTMGARLNKFYESWEDSPDIGFVMMKGSGRAFCAGGDVVGLHQLISE
GKMDEGKDFFRTLYSFIYVLGTYLKPHVAILDGVTMGGGGGVSIPGTFRIATDRTVFATP
EVHIGFHPDAAASFYLSHLTGHVGEYLALTGERLNGVDMLALGLATHYSMSEHLDLVDER
LATLVTDDPSVIDTSLAQYGDLVYPDKKSIVHRLEVIDKCFSHETVEEIVDALEGEAARL
NEEWCTLALKRLKEASPLALKVSLRSIREGRYQTLDECLVREYRMSINGISKPFSHEFCE
GVRARLVDKDLAPKWDPPALEFVSEDMVDSYFAPLGEFEPELKLPTELREAFI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcctcgccgccgccgctgccgcccgccgcgccggggaggcccttcgccgcggc
gtcatgggaggtatgcggtccctctcctcctctacagcgtcgcccgcgcccgccgccgcc
gctgccgccggccccgacagcgacgaggtgattgtggaaggcaaggccagtgcccgcgcc
gctgtgctcaaccgccccggccatctcaatgccctcaccaccaccatgggggctaggctg
aataagttctacgagtcatgggaggacagcccagatattggtttcgtcatgatgaagggc
agcggccgagcattctgtgctggtggggatgttgttggattgcaccaacttatcagtgaa
ggcaagatggatgagggtaaggattttttccggactttgtacagtttcatctatgttcta
ggcacgtacttgaaaccgcatgttgccattcttgatggtgttactatgggcggcggagga
ggtgtttccattcctggaacatttcgcattgccactgacagaacagtgtttgccactcca
gaagtacatattggcttccatcctgatgctgctgcctccttttatttgtcacatctaact
ggtcatgttggagaatacctggccttgaccggtgaaagactcaatggagttgatatgctt
gcacttgggcttgctacacactattccatgagtgagcaccttgatctggttgatgaacga
cttgcgacattggtcactgatgatccatctgttattgatacttctcttgcacaatatggg
gaccttgtttatccagacaagaaaagcattgtgcataggctggaggttatagataaatgc
ttcagccatgaaacagttgaagagattgtggatgcattggaaggtgaagcggctaggttg
aatgaagaatggtgtacgttggcattgaaacgattgaaagaggcctctccacttgccttg
aaagtctcgctgcgatcgatacgtgaaggtagatatcagacacttgatgaatgccttgta
cgtgaataccgcatgtccatcaatggaatctcaaagccattttctcatgaattctgtgag
ggtgttagagcacgattagtggacaaggacttggctccgaagtgggatcctccagcgctt
gagttcgtctcggaggacatggttgattcgtacttcgcccctctgggggaattcgagcct
gagcttaagctacctactgaattacgagaggcattcatttag

DBGET integrated database retrieval system