KEGG   Brachypodium distachyon: 100839540Help
Entry
100839540         CDS       T01717                                 

Definition
beta-hexosaminidase subunit B2-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bdi  Brachypodium distachyon
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100839540
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100839540
   00603 Glycosphingolipid biosynthesis - globo series
    100839540
   00604 Glycosphingolipid biosynthesis - ganglio series
    100839540
   00511 Other glycan degradation
    100839540
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100839540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 523 aa AA seqDB search
MAMAMRLILLLPVIGCATAAGGGRVDLWPMPASVSSGDKALYVAKDLKMSAVGSKYADGK
TILVEAFQRIVSVIQMDHAIVGSYDRLPVLTGVNVVVHSPDDELKFGVDESYNLSIPATG
SPMYAQIEAQTVFGALHALETISQLCYFDFVLSITRLDSAPWTIMDMPRFPYRGLLIDTA
RHYLPVPVIKSVIDSMTYSKLNVLHWHIVDEQSFPIEIHSYPELSNGAYSYSEKYTISDA
LDIVQYAEKRGVNVLAEIDIPGHARSWGVGYPSLWPSASCQQPLDVSNDFTFKVIDGILS
DFSKVFKFKFVHLGGDEVDTSCWATTPHIKSWLVQHGMNESDAYRYFVVRAQKIAISHGY
DIINWEETFNNFGDKLDRKTVVHNWLGRGVAEKAVSAGLRCIVSNADKWYLDHLDATWEG
FYMNEPLANIYNPEQQKLILGGEVCMWGERIDASDIQQTIWPRAAAAAERLWTPVEKLAK
NVTTVTARLARFRCLLNERGVAAAPLAGYGRAAPLEPGSCMRQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcgatgaggcttatcctgctgctccccgtgatcggctgcgccaccgctgct
ggcggtgggcgcgtcgatctgtggccaatgccggcgtcggtcagcagtggggacaaggca
ctctacgtcgccaaggacctcaagatgtcggcggtcgggagcaagtacgccgacgggaag
actatcctggtagaagccttccagaggatagtgtcagtcatccagatggaccatgctatc
gttggcagttacgacaggcttcctgtgctcaccggtgttaatgtagttgtccattccccg
gatgacgagctcaaattcggggtggatgaatcatacaacctgtcaattcctgcaactggc
agcccgatgtatgcccaaattgaggcacaaacagtttttggggcgcttcatgctttggag
acaattagccaattgtgttactttgattttgttttgagcataactcgacttgattcggct
ccttggactatcatggacatgccaagatttccttatcgagggcttcttattgatactgca
aggcattatcttcctgtcccagtaatcaaaagtgtaattgattcaatgacctacagtaag
ttgaatgtgcttcattggcatatcgtggatgagcaatcatttcctattgaaatacattca
tacccagaactatcaaatggtgcatactcctattcagagaaatatacaatcagtgatgca
cttgacattgtacaatatgctgaaaaacgaggtgtgaacgtcttggctgagattgatatc
cctgggcatgctcgctcatggggtgttgggtatccgtcattgtggccatcagctagctgc
caacaaccacttgatgttagcaatgactttactttcaaagtgatcgatggaattctgtca
gattttagcaaggtttttaagttcaagtttgtccatttgggaggtgacgaagtcgataca
agttgctgggctacaacaccacacattaaatcatggttggttcaacatggtatgaacgag
tctgatgcctatagatattttgtagtaagagctcaaaagatagcaatttcgcatggctac
gacattattaactgggaagaaacatttaacaactttggagacaagttggaccgcaaaact
gtggtgcataactggcttggacgtggagttgcagagaaagcggtttctgctggtctgaga
tgcattgtaagcaacgcagataagtggtacctagatcacttggatgctacatgggaagga
ttttacatgaatgaaccattggcgaatatttacaacccagaacaacagaagttgattctg
ggtggtgaggtgtgcatgtggggagaacggatagacgcatctgacattcagcaaaccatt
tggccacgtgctgcggcagctgcagagcggctgtggactcccgttgagaagcttgcaaag
aatgtaacaacggtgactgcaagattggcacgcttcagatgtttactgaatgaaagaggg
gtcgctgctgcaccactagctggatatggccgcgcagcgccattggaaccaggatcctgc
atgaggcaatag

DBGET integrated database retrieval system