KEGG   Brachypodium distachyon: 100839540Help
Entry
100839540         CDS       T01717                                 

Definition
(RefSeq) beta-hexosaminidase 3-like
Organism
bdi  Brachypodium distachyon
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 157 aa AA seqDB search
MAMAMRLILLLPVIGCATAAGGGRVDLWPMPASVSSGDKALYVAKDLKMSAVGSKYADGK
TILVEAFQRIVSVIQMDHAIVGSYDRLPVLTGVNVVVHSPDDELKFGVDESYNLSIPATG
SPMYAQIEAQTVFGALHALEVTSHDLSTSSDIMQDHR
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcgatgaggcttatcctgctgctccccgtgatcggctgcgccaccgctgct
ggcggtgggcgcgtcgatctgtggccaatgccggcgtcggtcagcagtggggacaaggca
ctctacgtcgccaaggacctcaagatgtcggcggtcgggagcaagtacgccgacgggaag
actatcctggtagaagccttccagaggatagtgtcagtcatccagatggaccatgctatc
gttggcagttacgacaggcttcctgtgctcaccggtgttaatgtagttgtccattccccg
gatgacgagctcaaattcggggtggatgaatcatacaacctgtcaattcctgcaactggc
agcccgatgtatgcccaaattgaggcacaaacagtttttggggcgcttcatgctttggag
gtaacttcacatgatttatccacttcaagtgatattatgcaggaccatagataa

DBGET integrated database retrieval system