KEGG   Brachypodium distachyon: 100839794Help
Entry
100839794         CDS       T01717                                 

Definition
4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic-like
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bdi  Brachypodium distachyon
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100839794
Enzymes [BR:bdi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     100839794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 586 aa AA seqDB search
MALARTLPLPHLAPAPASPGRLRGCIRVLPALSSQAGAPPAARGIACRSSKATTMTTTAA
EVAAVGVGEELPEGYEQMMPTVEESRRRRAGVLLHPTSLRGPHGIGDLGDEALAFLHWLR
DAGCTLWQVLPLVPPGRKSGEDGSPYSGQDANCGNTLLISLEELVKDGLLMEDELPAPLD
VEYVEFDTVANLKEPLIAKAAERLLLSHGELRMQYDEFKRNPDISGWLEDAALFAAIDKS
IDALSWYEWPEPLKNRHLGALEDIYQKQKDFIEIFMAQQFLFQKQWQRVRTHAQKLGISI
MGDMPIYVGYHSADVWANRKSFLLDKNGFPTFVSGVPPDAFSETGQLWNSPLYDWKFMEA
DGFTWWVKRIKRALDLYDEFRIDHFRGLAGFWAVLSDAEVAMVGSWRAGPRNAFFDALFK
AVGRANIIAEDLGVITGDVVELRKSIGAPGMAVLQFAFSGGSGNPHLPHNHELNQVVYTG
THDNDTVVGWWKSLPEEEKQTVLKYLPEASKTDVSWALITTALSSVARTSMVTMQDILGL
DSSARMNTPATQKGNWRWRIPSSVSFDSLNPEAAKLKELLAFYSRL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgcgcgaaccctcccgctcccgcacctcgctccggccccggcctcgcccggc
cgcctccgcggctgcatccgcgtcctccccgcattgtcctcccaggcgggcgcacccccc
gcggcgcgagggatcgcctgccgctcctcgaaggcgacgacgatgacgacaacggcggcg
gaggtggcggcggtgggcgtcggggaggagcttcccgaggggtacgagcagatgatgccg
accgtggaggagtcccggcggcggcgcgcgggcgtgctgctgcacccgacgtcgctccgc
ggcccgcacggcatcggcgacctcggcgacgaggcgctcgccttcctccattggctccgc
gacgccggatgcacgctctggcaggttcttccacttgttcctcctggaagaaaatccggg
gaggatggttctccttattcaggacaggatgcaaactgtggtaataccctattgatttct
cttgaagagcttgtaaaagatgggctcttgatggaagatgaacttcctgcacccttggat
gtggaatatgttgaatttgacactgttgctaatctgaaagaacctcttattgcaaaggca
gcagagaggctcctactgagtcatggagagctcagaatgcagtatgacgaattcaagaga
aatccagatatttcaggctggcttgaagatgctgcactatttgctgctattgacaaaagc
attgatgcattgtcctggtatgagtggcctgaaccactgaaaaatcgccatcttggagcc
ttggaagacatatatcaaaaacagaaagactttatcgagatttttatggcacagcagttc
ttatttcaaaagcagtggcaacgtgttcgtacacatgcacagaagctgggcatcagcata
atgggcgacatgcctatttatgttggctaccacagtgcagatgtttgggcaaacaggaaa
tcatttttgctggacaagaatggtttccccacatttgttagtggtgttccacctgatgca
tttagtgaaactggtcagctatggaacagtccactgtacgactggaaatttatggaagct
gatggttttacatggtgggtaaagaggattaaacgtgcccttgatttgtacgatgagttc
cgtatagatcatttccggggacttgctggtttttgggcagttctgtctgacgcagaagta
gcgatggttggaagctggagggctggaccgaggaatgccttttttgatgcgctcttcaaa
gctgttggtagagcaaatataatagcagaagacctgggcgtgataactggagatgttgtt
gagctaaggaaatctattggggctcctggaatggcagttcttcagtttgcttttagcggt
ggttctggcaacccccacttgcctcataaccatgaactgaatcaagttgtatacactggg
acacatgataatgatacggttgttggctggtggaagagtttgccagaggaagagaagcag
actgtgctcaagtatctaccagaggccagcaagactgatgtctcgtgggcactaattact
actgccctctcttcggttgcgaggacttccatggtaaccatgcaggacatacttggcctc
gacagttctgctaggatgaatactccagctacacagaaaggaaattggagatggaggata
ccaagctccgtcagctttgacagccttaaccctgaagcagcaaaactgaaggagttgctt
gcattttacagccggctgtga

DBGET integrated database retrieval system