KEGG   Brachypodium distachyon: 100839814Help
Entry
100839814         CDS       T01717                                 

Definition
threonine synthase, chloroplastic-like
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bdi  Brachypodium distachyon
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100839814
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100839814
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100839814
Enzymes [BR:bdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     100839814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 525 aa AA seqDB search
MAAAATHASSLSFLLSRPHSSSPHQLRLRRPADHRVRCATDASAAAAAPAKHRRAADENI
REEAARHPAPNNDFSAWYEPFPPGAPGGDNPDERYSLDEIVYRSSSGGLLDVRHDMEALA
RFPGSYWRDLFDSRIGRTTWPYGSGVWSKKEFVLPEIDPEHIVSLFEGNSNLFWAERLGR
DHLGGMKDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRRAPLSRPIAGVGCASTGDTSAA
LSAYCAAAGIPAIVFLPANRISLEQLIQPIANGATVLSLDTDFDGCMRLIREVTAELPIY
LANSLNSLRLEGQKTAAIEILQQFDWEVPDWIIVPGGNLGNIYAFYKGFEMCRVLGLVDR
LPRLVCAQAANANPLYRYYKSGWTEFQPQVAEPTFASAIQIGDPVSVDRAVVALKATNGI
VAEATEEELMNAMSLADRTGMFACPHTGVALAALFKLREQRVIGPNDRTVVVSTAHGLKF
SQSKIDYHDRKIEDMACKYANPPVSVKADFGAVMDVLKTRLKGKL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccgccacccacgcctcctccctctccttcctcctctcccgccctcactcc
tcctccccccaccagctccgcctccgcaggcccgccgaccaccgcgtgcgctgcgccacc
gacgcctccgccgccgcggccgcccccgccaagcaccggcgcgcggcggacgagaacatc
cgcgaggaggcggcgcggcacccggccccgaacaacgacttctccgcctggtacgagccg
ttcccgccgggggcccccggcggcgacaaccccgacgagcgctactccctggacgagatc
gtctaccgctccagctcggggggcctcctcgacgtgcgccacgacatggaagccctggcc
cgcttcccgggctcctactggcgtgacctcttcgactcccgcatcggccgcaccacctgg
ccctacggctccggcgtctggtccaagaaggagttcgtgctcccggagatcgacccggag
cacatcgtctccctcttcgagggcaactccaacctcttctgggccgagcggctcggccgc
gaccacctcggcgggatgaaggacctctgggtcaagcactgcggcatctcccacacgggg
tccttcaaggacctcggcatgaccgtgctcgtcagccaggtcaaccgcctccgccgcgcg
ccgctctcccgccccatcgccggcgtcggctgcgcctccacgggggacacctccgccgcg
ctctccgcctactgcgccgccgccgggatccctgctattgtgttcttacccgccaaccgc
atctcgctcgagcagctcatccagcccattgccaacggcgccaccgtgctctccctggac
acggactttgatggctgcatgcggctcatcagggaggtcactgccgagctgccgatttac
cttgccaattcgctcaattcgcttcggctcgaggggcagaagacggcggccattgagata
ctgcagcagttcgattgggaggtgccagattggatcattgtccccggaggcaatctcgga
aacatatatgcgttctacaagggattcgagatgtgccgtgttctgggtcttgtagatcgg
ctgccgcggcttgtctgcgcacaggctgccaatgccaacccgttgtaccggtactacaag
tcagggtggactgagttccagccacaagtggctgagccgacatttgcctctgcgattcag
attggtgaccctgtttctgtcgaccgagctgtcgttgcactgaaggcgacgaatggcatt
gttgctgaggccacggaggaggagctcatgaatgctatgtctctcgctgaccgcactggc
atgtttgcttgcccgcatactggggttgcccttgcggcgctgttcaagctccgggagcag
cgtgtcattgggccaaacgaccgcacggtggtcgtcagcacagcacacggtctgaagttc
tcccagtccaagattgactaccatgatcgcaagattgaagacatggcttgcaagtatgct
aacccacctgtcagtgtgaaggccgactttggtgctgtcatggatgtcttgaagactagg
ctcaagggtaagctctga

DBGET integrated database retrieval system