KEGG   Brachypodium distachyon: 100839875Help
Entry
100839875         CDS       T01717                                 

Definition
protein disulfide isomerase-like 1-2-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bdi  Brachypodium distachyon
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100839875
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100839875
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100839875
  Exosomal proteins of colorectal cancer cells
   100839875
  Exosomal proteins of bladder cancer cells
   100839875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 520 aa AA seqDB search
MAVPLALPSAAIIIVVLLLSSGLTTAEVEVAAVLEEAVLTLDVSNFSEVVGKLQFIVVEF
YAPWCGHCKELAPEYEKAASMLRKHDPPVVLAKVDAYDEGNKELKDKYEVHGYPAIKIIR
NGGSDVSGYAGARNADGIVEYLKKQVGPASIELRSALDATRSIGDKGVVLVGIFPEFAGV
EYENFMAVADKMRSDYDFFHTSDASILPHGDQNVKGPLVRLFKPFDELFVDSQDFDKDAI
KKFIEVSGFPTVVTFDDEPTNHKFLERYYSTPSAKAMLFLRFSDDRVEAFKSQMHEAARQ
LSGNNISFLIGDVSAAERAFQYFGLKESDIPLLLVIASTGKYLNPTMDPDQLIPWMKQYI
YGNLTPYVKSEPIPKVNDQPVKVVVADNIDDIVFNSGKNVLLEFYAPWCGHCRKLAPILE
EVAVSFRNDEDIVIAKMDGTANDVPTDFVVEGYPALYFYSSSGGEILSYKGARTAEEIIS
FIKKNRGPKAGALEEVTQTDAVQEEVTSTSSPSESVKDEL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggccgtccccttggctctcccttctgcagccatcatcatagtagtgcttctgctctcc
tctggcctcactacagcggaggtggaggtcgctgctgtgctggaagaggcggtccttacg
ctggacgtgagcaacttctcagaggtggtggggaaactccagttcattgtggtcgagttc
tacgcgccatggtgtggccactgcaaggaactcgctcctgagtacgagaaggcagcctcc
atgctgaggaaacatgacccaccggtggtgctcgcaaaggtggacgcatacgacgaggga
aacaaggaactcaaggacaagtacgaggtgcatgggtatccggccatcaagatcatcagg
aacgggggcagcgacgtgagtggctacgccggcgcgaggaacgctgacggcatcgtggag
tacctcaagaaacaggtcggcccggcgtccatcgagctcaggtcggcactggatgccacc
cgatccatcggcgacaaaggggtggtccttgtgggaatatttcctgagtttgctggtgta
gagtatgaaaacttcatggctgtggcagacaagatgcgctcggattatgatttcttccac
acatcggatgcaagcattctaccacatggcgatcagaacgtcaagggcccccttgttcga
ctctttaagccatttgatgagctgtttgtcgattctcaagattttgataaggatgcaatc
aagaagtttattgaggtgtctggtttccctaccgtagttacctttgatgatgaaccgacc
aaccataagttcctcgaaagatactacagcacacctagtgctaaagcaatgcttttctta
cgcttcagcgatgacagagttgaggccttcaagagccagatgcatgaagcagccaggcag
ctcagtggcaataacataagttttctaattggtgatgtttcagccgctgaacgtgccttc
cagtatttcgggctcaaagaaagtgatattcctctcctcctcgtgatagcatcaaccgga
aaataccttaatccaactatggaccctgatcagctcataccgtggatgaagcaatatata
tatggtaacttgactccttatgttaagtcagagccaatccccaaggtcaatgaccaaccc
gttaaggttgttgtggctgacaatattgatgacattgtcttcaactctggcaaaaatgtt
ctactggaattctatgcaccttggtgtggtcattgccgaaagttggccccgatactggag
gaagttgcggtctcgtttcgaaacgatgaagatatagtcatagcaaagatggatggcact
gcgaacgatgtcccaacagactttgtggtcgaagggtatccagctctatacttctattct
tctagtggtggagaaattttatcatataagggtgcgaggacagcagaggagatcatcagt
tttatcaagaagaaccggggtcccaaagctggtgcgctggaagaagtaacccagacagat
gctgtgcaagaggaggtaacatcaacatcgtcaccatcggaatccgttaaagatgaactc
taa

DBGET integrated database retrieval system