KEGG   Brachypodium distachyon: 100839875Help
Entry
100839875         CDS       T01717                                 

Definition
protein disulfide isomerase-like 1-2-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bdi  Brachypodium distachyon
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:bdi04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 520 aa AA seqDB search
MAVPLALPSAAIIIVVLLLSSGLTTAEVEVAAVLEEAVLTLDVSNFSEVVGKLQFIVVEF
YAPWCGHCKELAPEYEKAASMLRKHDPPVVLAKVDAYDEGNKELKDKYEVHGYPAIKIIR
NGGSDVSGYAGARNADGIVEYLKKQVGPASIELRSALDATRSIGDKGVVLVGIFPEFAGV
EYENFMAVADKMRSDYDFFHTSDASILPHGDQNVKGPLVRLFKPFDELFVDSQDFDKDAI
KKFIEVSGFPTVVTFDDEPTNHKFLERYYSTPSAKAMLFLRFSDDRVEAFKSQMHEAARQ
LSGNNISFLIGDVSAAERAFQYFGLKESDIPLLLVIASTGKYLNPTMDPDQLIPWMKQYI
YGNLTPYVKSEPIPKVNDQPVKVVVADNIDDIVFNSGKNVLLEFYAPWCGHCRKLAPILE
EVAVSFRNDEDIVIAKMDGTANDVPTDFVVEGYPALYFYSSSGGEILSYKGARTAEEIIS
FIKKNRGPKAGALEEVTQTDAVQEEVTSTSSPSESVKDEL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggccgtccccttggctctcccttctgcagccatcatcatagtagtgcttctgctctcc
tctggcctcactacagcggaggtggaggtcgctgctgtgctggaagaggcggtccttacg
ctggacgtgagcaacttctcagaggtggtggggaaactccagttcattgtggtcgagttc
tacgcgccatggtgtggccactgcaaggaactcgctcctgagtacgagaaggcagcctcc
atgctgaggaaacatgacccaccggtggtgctcgcaaaggtggacgcatacgacgaggga
aacaaggaactcaaggacaagtacgaggtgcatgggtatccggccatcaagatcatcagg
aacgggggcagcgacgtgagtggctacgccggcgcgaggaacgctgacggcatcgtggag
tacctcaagaaacaggtcggcccggcgtccatcgagctcaggtcggcactggatgccacc
cgatccatcggcgacaaaggggtggtccttgtgggaatatttcctgagtttgctggtgta
gagtatgaaaacttcatggctgtggcagacaagatgcgctcggattatgatttcttccac
acatcggatgcaagcattctaccacatggcgatcagaacgtcaagggcccccttgttcga
ctctttaagccatttgatgagctgtttgtcgattctcaagattttgataaggatgcaatc
aagaagtttattgaggtgtctggtttccctaccgtagttacctttgatgatgaaccgacc
aaccataagttcctcgaaagatactacagcacacctagtgctaaagcaatgcttttctta
cgcttcagcgatgacagagttgaggccttcaagagccagatgcatgaagcagccaggcag
ctcagtggcaataacataagttttctaattggtgatgtttcagccgctgaacgtgccttc
cagtatttcgggctcaaagaaagtgatattcctctcctcctcgtgatagcatcaaccgga
aaataccttaatccaactatggaccctgatcagctcataccgtggatgaagcaatatata
tatggtaacttgactccttatgttaagtcagagccaatccccaaggtcaatgaccaaccc
gttaaggttgttgtggctgacaatattgatgacattgtcttcaactctggcaaaaatgtt
ctactggaattctatgcaccttggtgtggtcattgccgaaagttggccccgatactggag
gaagttgcggtctcgtttcgaaacgatgaagatatagtcatagcaaagatggatggcact
gcgaacgatgtcccaacagactttgtggtcgaagggtatccagctctatacttctattct
tctagtggtggagaaattttatcatataagggtgcgaggacagcagaggagatcatcagt
tttatcaagaagaaccggggtcccaaagctggtgcgctggaagaagtaacccagacagat
gctgtgcaagaggaggtaacatcaacatcgtcaccatcggaatccgttaaagatgaactc
taa

DBGET integrated database retrieval system