KEGG   Brachypodium distachyon: 100839912Help
Entry
100839912         CDS       T01717                                 

Definition
(RefSeq) serine/threonine protein kinase OSK1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100839912
Protein kinases [BR:bdi01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100839912
Membrane trafficking [BR:bdi04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100839912
Mitochondrial biogenesis [BR:bdi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100839912
  Mitophagy factors
   Other mitophagy factors
    100839912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr KA1 Kinase-like AdenylateSensor RIO1 UBA Kdo Haspin_kinase UBA_2 APH
Motif
Other DBs
NCBI-GeneID: 100839912
NCBI-ProteinID: XP_003568040
Position
2
AA seq 500 aa AA seqDB search
MDAAGRDANPLKGYRIGKTLGIGSFGKVKIAEHIITGHKVAIKILNRRKIKSMEMEEKVK
REIKILRLFMHPHIIRLYEVIDTPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQ
IISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNVMRDGHFLKTSCGSPNYAAP
EVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPLAR
DLIPRMLVVDPMKRITIREIREHSWFKARLPRYLAVPPPDTAQQIKKLDDETLNDVIKMG
FDKIQLTESLQKRLQNEATVAYYLLLDNKLRTTSGYLGAEYQESMDSSFSQISPETPNSA
SEARQFGSPAFGLRQHFAAERKWALGLQSRAHPREIITEVLKALQELNVCWKKIGHYNMK
CRWNPGFVENMMHNNHGFGVESAIIESDDLSEKSTHIVKFEIQLYKTRDEKYLLDLQRVS
GPQLLFLDLCSAFLTQLRVL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagccggcagagatgcaaacccattgaaaggctaccgcatcggcaaaaccttg
ggcattgggtcctttggcaaagtgaagatcgcggagcatataattacaggccacaaggtg
gcaatcaagatcctcaatcgccggaaaatcaaaagcatggagatggaagagaaagtgaaa
agagaaatcaagatcctgagattatttatgcatccccatatcatacggctttatgaggtg
atagatacaccagctgatatatatgttgttatggagtatgtcaaatctggagagttgttt
gattacattgtcgagaagggaaggttgcaagaggaggaagctcgtcgctttttccagcaa
attatatctggtgtggaatattgccatagaaatatggtggttcaccgtgatctgaagcca
gagaaccttctgttggattcgaaatgcaatgttaagattgcagattttggcttaagtaat
gttatgcgtgatggtcactttctgaagactagttgtggtagcccgaattatgcagcaccc
gaggtgatatcaggtaaactatatgctggccctgaagttgatgtttggagctgtggtgtt
attctttatgctcttctttgtggtactcttccatttgatgatgagaatataccaaacctt
tttaagaaaataaagggtggaatatacacccttcctagtcacttgtctcctttagcaaga
gatttaatccccagaatgctggtcgttgatcctatgaagaggatcaccatacgtgaaatc
cgtgaacattcgtggttcaaagctcgacttccacgctatttggctgtgcctcctccagac
actgcacagcaaattaaaaagctggatgatgaaactcttaatgatgttatcaagatggga
tttgataagattcagctaactgagtctcttcaaaagagattgcaaaatgaggccacagtt
gcatattatttactcttggacaataagcttcgtacaaccagcggctaccttggagctgag
tatcaagaatcgatggattcatctttctctcaaatttcccctgaaacaccaaattctgca
tctgaagctcggcagtttggttctcctgcatttggcttgaggcaacattttgcagccgag
agaaaatgggctcttggtctccagtctcgagcacatccacgagaaattataaccgaagtg
cttaaagctcttcaagagctaaatgtttgctggaagaagattgggcactataacatgaag
tgcaggtggaatcctggctttgtcgagaatatgatgcataacaaccatggcttcggtgtg
gagtctgccataattgaaagtgatgacctcagtgagaagtcaacccacattgtgaagttt
gaaatccagctttacaaaacaagggatgagaaatatcttctggacttgcaaagggttagt
ggaccacagctcctgtttctggacctgtgttctgcctttctaactcagctgagagtcctt
tga

DBGET integrated database retrieval system