KEGG   Brachypodium distachyon: 100839912Help
Entry
100839912         CDS       T01717                                 

Definition
SNF1-related protein kinase catalytic subunit alpha KIN10-like
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
bdi  Brachypodium distachyon
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100839912
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100839912
Protein kinases [BR:bdi01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100839912
Mitochondrial biogenesis [BR:bdi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100839912
  Mitophagy factors
   Other mitophagy factors
    100839912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 500 aa AA seqDB search
MDAAGRDANPLKGYRIGKTLGIGSFGKVKIAEHIITGHKVAIKILNRRKIKSMEMEEKVK
REIKILRLFMHPHIIRLYEVIDTPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQ
IISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNVMRDGHFLKTSCGSPNYAAP
EVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPLAR
DLIPRMLVVDPMKRITIREIREHSWFKARLPRYLAVPPPDTAQQIKKLDDETLNDVIKMG
FDKIQLTESLQKRLQNEATVAYYLLLDNKLRTTSGYLGAEYQESMDSSFSQISPETPNSA
SEARQFGSPAFGLRQHFAAERKWALGLQSRAHPREXITEVLKALQELNVCWKKIGHYNMK
CRWNPGFVENMMHNNHGFGVESAIIESDDLSEKSTHIVKFEIQLYKTRDEKYLLDLQRVS
GPQLLFLDLCSAFLTQLRVL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagccggcagagatgcaaacccattgaaaggctaccgcatcggcaaaaccttg
ggcattgggtcctttggcaaagtgaagatcgcggagcatataattacaggccacaaggtg
gcaatcaagatcctcaatcgccggaaaatcaaaagcatggagatggaagagaaagtgaaa
agagaaatcaagatcctgagattatttatgcatccccatatcatacggctttatgaggtg
atagatacaccagctgatatatatgttgttatggagtatgtcaaatctggagagttgttt
gattacattgtcgagaagggaaggttgcaagaggaggaagctcgtcgctttttccagcaa
attatatctggtgtggaatattgccatagaaatatggtggttcaccgtgatctgaagcca
gagaaccttctgttggattcgaaatgcaatgttaagattgcagattttggcttaagtaat
gttatgcgtgatggtcactttctgaagactagttgtggtagcccgaattatgcagcaccc
gaggtgatatcaggtaaactatatgctggccctgaagttgatgtttggagctgtggtgtt
attctttatgctcttctttgtggtactcttccatttgatgatgagaatataccaaacctt
tttaagaaaataaagggtggaatatacacccttcctagtcacttgtctcctttagcaaga
gatttaatccccagaatgctggtcgttgatcctatgaagaggatcaccatacgtgaaatc
cgtgaacattcgtggttcaaagctcgacttccacgctatttggctgtgcctcctccagac
actgcacagcaaattaaaaagctggatgatgaaactcttaatgatgttatcaagatggga
tttgataagattcagctaactgagtctcttcaaaagagattgcaaaatgaggccacagtt
gcatattatttactcttggacaataagcttcgtacaaccagcggctaccttggagctgag
tatcaagaatcgatggattcatctttctctcaaatttcccctgaaacaccaaattctgca
tctgaagctcggcagtttggttctcctgcatttggcttgaggcaacattttgcagccgag
agaaaatgggctcttggtctccagtctcgagcacatccacgagaanatataaccgaagtg
cttaaagctcttcaagagctaaatgtttgctggaagaagattgggcactataacatgaag
tgcaggtggaatcctggctttgtcgagaatatgatgcataacaaccatggcttcggtgtg
gagtctgccataattgaaagtgatgacctcagtgagaagtcaacccacattgtgaagttt
gaaatccagctttacaaaacaagggatgagaaatatcttctggacttgcaaagggttagt
ggaccacagctcctgtttctggacctgtgttctgcctttctaactcagctgagagtcctt
tga

DBGET integrated database retrieval system