KEGG   Brachypodium distachyon: 100840064Help
Entry
100840064         CDS       T01717                                 

Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100840064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 697 aa AA seqDB search
MDSSAALDMLAALLTGREGASLLALAEDNRRILALLTTSLAVLVGCGVALFLRRSSSAAG
PQPATASRPLAAKAREKEPDPDDGRLRVAVFFGTQTGTAEGFAKALAEEAKARYDKAVFK
VVDLDDYAAEDDDYAEKLKKEIIALFFLATYGDGEPTDNAARFYKWFSEGNERGEWLSNL
RFAVFGLGNRQYEHFNKIGKVVDQLLSEQGGKRIVPVGLGDDDQCIEDDFNAWKELLWSE
LDKLLRVEDDSSVPPTPYTAAIPGYRTVFVKPEDAADINKSSSLSNGQAVYDIQHPCRAH
VAVRRELHTPASDRSCIHLEFDIAGTSLTYETGDHVGVYAENNIETVKEAEKLLGYSADT
VFAIYADEEDGTPLFGGSLPPPFPSPCTVRVALARYADLLNSPKKSVLIALAAHASDPKE
AERLRHLASPAGKKEYSQWIISSQRSLLEVISEFPSVKPPLGVFFAAIAPRLQPRYYSIS
SSPRMAPTRIHVTCALVCGPTPTGRIHKGVCSTWMKNSTPLEESEECSWAPIFVRQSNFK
LPADPTVPIIMIGPGTGLAPFRGFLQERLALKEIGVELGRAILFFGCRNRKMDFIYEDEL
NNFADAGALSELIVAFSRDGPTKEYVQHKMAAKAPELWSIISQGGYIYVCGDAKGMARDV
HRVLHTIVQGQGSLDNSKTESYMKNLQMEGRYLRDVW
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggactcgtcggcggcgctggacatgctggcggcgctgctgacgggccgggagggcgcg
tcgctcctcgcgctggccgaggacaaccgccgcatcctcgccctgctcaccacctcgctc
gccgtgctcgtcggctgcggcgtcgccctcttcctccgccgctcctcctccgcggccgga
ccgcagccggcgacggcgtcgcggcccctcgccgccaaggcgcgggagaaggagcccgac
ccggacgacggccgcctgagggtcgccgtcttcttcggcacgcagaccggcaccgccgag
ggcttcgccaaggcgctcgcggaagaggccaaggcgaggtacgacaaagccgtcttcaag
gtggtcgatctggatgattacgcggcagaggacgatgactacgcggagaagcttaagaag
gagatcatcgcattgttcttcctggccacgtatggggacggtgagccaactgacaatgcg
gcgaggttttataaatggttctcagaggggaatgagaggggtgaatggttgagcaatctc
cggtttgcggtgtttggccttggaaataggcagtatgagcattttaacaagattggaaag
gttgttgatcagctcctcagtgaacaaggtggcaaacgcattgttcctgttggtctggga
gatgatgatcaatgcattgaggatgacttcaacgcctggaaggaattgctatggtcagaa
ttggataaattgctccgtgttgaggatgattcttcagtaccaccaactccttacacagct
gctattccgggatatagaactgtgttcgtcaaaccagaggatgccgcagatatcaacaag
tcttccagtcttagcaacggccaagctgtctatgacattcaacatccgtgcagggcacac
gtggcagtgcgacgggagcttcatacgccagcttctgaccggtcctgcattcatttagag
tttgatattgcaggaactagcctcacatatgagactggagatcatgttggcgtgtatgca
gaaaataacatcgagaccgtaaaggaggcagaaaagctgttaggttattcagcagataca
gttttcgcaatttatgctgacgaagaggatggcactccactttttgggggatctcttcca
cctcctttcccatctccttgtacagtgagggttgcccttgctagatacgccgatcttttg
aattcacctaagaagagtgttttaatagctttggctgctcatgcatctgatcccaaagaa
gctgagcgtctaagacatttagcatctcctgctggaaagaaggaatattctcaatggata
atctcaagtcaaagaagtctcttggaagttatttctgagttcccatcagtgaaacctccg
ctcggtgtcttctttgcagctattgctcctcgcctgcagccgagatactactcaatatct
tcctcaccccgaatggcaccaacaagaattcatgtcacgtgtgcactagtttgtgggcca
acgcctactggaaggatccacaaaggagtttgttctacttggatgaagaattcaactccc
ttggaagagagtgaagaatgtagttgggctccaatttttgtgaggcagtcaaacttcaaa
ctgcctgctgatcctacagtacctattatcatgataggtcctgggactggtcttgcacct
ttcaggggcttcttacaggaaagattagctttaaaagagatcggggtggaattaggccgt
gcgatcctcttctttgggtgcagaaaccgcaagatggacttcatatatgaggatgagctc
aacaattttgctgatgctggtgctctgtctgagttgattgttgctttctctcgtgacggt
cccacaaaagagtatgttcaacacaaaatggcagcgaaggctcctgagctttggagcatc
atttctcaggggggttatatttatgtctgtggcgacgcgaagggcatggctagagatgtg
catcgtgtactacacacaattgtccagggacagggctctttggacaactcgaagacggag
agctacatgaagaacctgcagatggaggggagatacttaagagatgtctggtga

DBGET integrated database retrieval system