KEGG   Brachypodium distachyon: 100840139Help
Entry
100840139         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase 16-like
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 970 aa AA seqDB search
MAEVPGSSTAAAVLAVVMLVVVPAMALLVRRSLRQAAARREEVRRRARLAAEESELAERE
SVRAYYAELFPGVVHAAEVPEAPMWTPQPVAPAHEEPEVVAETQQQPQPPVGVCAVCFKP
TTFRCKQCKAVKYCSFKCQIAHWRQGHKDECHPPSVNARPDDAAEISVAKEGKAEQGGAS
EETDINMPVAVGSETSSANHTLRSLNDKRKDMPFKEVPATTEVPENGHSDSVVKLRQSTP
QVASLDSKKTESNIKPTNFVENGSYKDLDEVLIYKSQASAPKMSGHSSYINEDLSVHSKE
HGKARDADVGVDYSQASRARKPADMNNSQAAATVAMAPKSSRASLRVEVEESKIKVTCTD
NIESSKCVPSVLAANKVSSIRDVCSVTPNPSKRADNPSERAGSTANSLASSLKKIVRQQT
ASKVVRHYPSELTLFPYELFIKLYDKVELRPFGLHNLGNSCYANAVLQCLMFTRPLTAYF
LGGLHSKNCSNKEWCFMCEFEKLVVEGKHGKTALSPTGILSHLHEIGSSFGPGKQEDAHE
FLRHSIDAMQSVCMKEARKSGAHRLAEETTLVQLIFGGYLRSKIKCTRCHGSSEQSERML
DLTVEIDGDISSLEEALQRFTSTEVLDGNNRYQCTRCKSYERAKKKLTISEAPNVLTIAL
KRYQSGKFGKISKAIRFPETLNLSSYMSTTDDNSPVYSLYGVVVHHDVMNAAFSGHYVCY
VKDTHGKWYKTDDSQVKSVSLENVMSKCAYMLLYARCSPRAPSSVRHAIMVQDPARAKKT
RHKQGPIPDHITDNLTGTFDEFGESPYPPAESPSPSESSSLFSNSDAGSHSTVSTDSSES
TRNSTSTDEYEQYLFGTPDQIYQGGSAAAHDETDYTTYSRSRSTLGTSSSGREADHAGSA
ERFIEQGTRGGWFEGGESSSYLYTDRSKQQSSSKLTEQYRQLGTEHDPGEVRGSVLSRRS
ARERTAQTFY
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgccggggtcgtcgaccgcggccgccgtgctggcggtggtgatgctcgtc
gtcgtgccggccatggcgctgctggtgcggcggagcctgcggcaagccgcggcgaggagg
gaggaggtgcggcgccgcgcgcggctcgcggcggaggagtccgagctggcggagcgggag
tcggtgcgcgcctactacgcggagctgttcccgggagtggtgcacgcggcggaggtgccg
gaggcgccgatgtggaccccgcagccggtggctccggcgcatgaggagccggaggttgtg
gcggagacgcagcagcagccccagccgccggtgggggtctgcgcggtatgcttcaagccg
accacgtttaggtgcaagcagtgcaaggccgtcaagtactgttccttcaaatgccagata
gcccactggagacaaggtcataaagatgaatgccatccaccaagtgtcaatgctaggcca
gatgatgcagctgaaatttctgttgcaaaagaaggaaaagctgaacagggtggagcttct
gaagaaactgatatcaacatgccagttgctgttgggtcagaaacttctagtgcaaaccat
actttgaggagcttaaatgataaaaggaaagatatgcctttcaaggaggtacctgctacc
actgaggttcctgaaaatggccattctgacagtgtggtcaaacttcgtcaaagtacccct
caagtagcatctcttgacagtaaaaagacggaatcaaatatcaagcctacaaattttgtt
gagaatggctcttacaaggacttagatgaggtgttgatttacaaatctcaagcttctgcg
ccgaagatgagcggccatagcagttatataaatgaagatttgtcagttcattccaaagaa
catggtaaagctcgggatgctgatgttggtgtggattactctcaggccagtcgtgctaga
aaacctgcagacatgaacaattctcaagctgctgcaactgttgccatggcacccaaaagt
tctagggcttctcttcgtgtggaagttgaagagtcaaaaataaaagtcacttgtactgac
aacatcgaaagctcaaaatgtgtgccatcggtcttagctgctaataaagtttcttccatt
cgtgatgtctgttctgtaacacctaatccatcaaaaagggctgataatccatcagagagg
gcaggttcaactgcaaatagccttgcgtcgtctctgaagaaaattgtcaggcaacaaact
gcttccaaagttgtgaggcattatccatcagaattgacactttttccatatgaacttttc
atcaagctctatgacaaggttgaattgcgcccttttggtcttcataaccttggcaatagt
tgctatgcaaatgctgttcttcagtgcttgatgtttactcggcctcttacagcatatttt
ttaggagggcttcattcaaaaaattgctccaataaggaatggtgtttcatgtgtgaattt
gaaaaacttgttgtggagggcaaacacggcaagactgctttgtcaccaactgggatactc
tcccatttgcacgagattggaagtagctttggccctggtaaacaagaagatgctcatgaa
tttcttcggcactccattgatgctatgcaatctgtatgcatgaaggaagccagaaaaagc
ggtgctcatcgtttagcagaagaaaccacacttgtgcaattgatattcgggggttatctg
cgatctaagataaaatgcacaaggtgccatggtagttccgagcaatctgagcgtatgttg
gatcttactgttgaaatagatggcgacatcagttcgctcgaagaagcacttcagcgattt
acatctacagaagtcttggatggaaataatagataccaatgcactagatgcaaatcgtac
gagcgtgctaagaagaagttgacaatatcagaagcaccaaatgtcctgacaattgcattg
aaaagatatcagtctggcaagttcgggaagatcagcaaagccatcagattcccagagacc
ctgaacttgtctagctacatgagcacaactgatgacaattcacctgtttacagcctatat
ggagtggttgtccatcatgatgttatgaatgctgccttttctggtcattatgtatgttac
gtcaaggacacacatgggaagtggtacaagacagatgacagtcaggtcaaatcggtgtcc
ctggaaaatgtcatgtcgaagtgtgcatacatgctgctctatgcaaggtgttcaccaagg
gcgccaagctctgtgcgacatgcgataatggttcaagaccctgcacgtgcgaagaagaca
aggcataagcaaggacctataccagatcacattactgataaccttactggtacatttgac
gaatttggagagtcaccatatccaccggcagaatctccaagtccaagtgagagttcatcg
ctgttcagcaactctgatgctgggtcacacagcacagtgagcacagatagcagtgaaagc
acaaggaattcaaccagcactgatgagtatgaacagtacttatttgggactccagatcaa
atttaccagggagggtctgcagcagcacacgacgagacagactatacaacatattcccgg
tcgagatctaccttgggcaccagctcatctggccgggaggcggatcatgcaggcagtgcc
gagagatttattgagcagggtaccagaggtggctggttcgagggtggtgagagctcgtcc
tacttgtacactgaccgaagtaaacaacagtcgagtagtaagttaacagaacaatatagg
cagttaggtacggagcatgaccctggagaagtcaggggcagtgttttatcgagaagatcg
gctagggaaaggaccgcccaaacattttattga

DBGET integrated database retrieval system