KEGG   Brachypodium distachyon: 100840346Help
Entry
100840346         CDS       T01717                                 

Definition
malonyl-CoA decarboxylase, mitochondrial-like
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
bdi  Brachypodium distachyon
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bdi00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bdi00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:bdi04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 508 aa AA seqDB search
MTRSHTPKSLAVLLRARMYADPIPSPPPAPSPPASPDSSAPPAAGAASVRHWLHASVSAA
SPSPAALDCFSDGYRSLDSRGRHEILRSLATDYDVPRARLHDLMLQYVSVSTTGEGGDEQ
PGAEREEGGAASALYRMERGLGDALRPKYAGFLEAMNAQPGGLKLLAVIRADLLALLGKE
NAPVLRALDGYLKEKLVTWLSPAALALHQITWDDPASLLEKIVAYEAVHPIRNLIDLKRR
LGIGRRCFGYFHPAIPGEPLIFIEVALLKDMATSIQEVLWDDPPIAECEAKCALFYSISS
TQPGLSGINLGKFLLKRVIDMLRRDMPSVQIFATLSPIPGFMQWLLAKLASQIKLAETEL
QEGNSLEGASSTFRESILLPEEEKIIHNAVEQVNDKQGIELLQDVLKSSQWVKSDKLSAA
LKSPLMRLCSRYLARERKRGKALDAVANFHLQNGAMIERINWMADQSEKGIKQSGGIMVN
YLYRLESIEEYALSYSATGLIHGSPGMS
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgactagaagccacaccccgaaatccctcgccgtcctgctccgtgcccggatgtacgcc
gaccctatcccttccccaccacccgctccgtcaccccccgccagccccgactccagtgcc
ccgcccgcagccggcgccgcatccgtccgccactggctccatgcttctgtctccgcggcc
tccccgtcccccgccgccctcgactgcttctcagatggctaccgctccctcgacagccgc
ggccgccacgagatcctccggtccctcgcgaccgattacgacgtgccccgcgcgcggctc
cacgacctcatgcttcagtacgtcagcgtctccaccaccggggagggtggggatgaacag
ccgggggcggagagggaggagggcggcgcagcttcggcgctctatcgtatggagcgtggt
cttggggatgcgctccggccaaagtacgctgggttccttgaggccatgaacgcgcagccc
ggtgggctcaagctcctcgctgtcatccgcgccgaccttctagcgttattggggaaagag
aatgctccggtgctgcgtgcattggacggttacttgaaggagaagctcgtgacgtggctc
agcccagcggctctggcactccaccagataacctgggatgatcctgcctccttgctggag
aagattgtggcttatgaagctgtgcatccaatcagaaatctaatagacttgaagagaagg
ctgggcattggccgccgttgtttcgggtacttccatcctgcgataccaggggagcccctg
attttcatcgaagttgctctcctgaaagacatggccacatctatacaggaagttttgtgg
gatgaccctccaattgctgaatgtgaagctaaatgtgcgctgttttactcaatttcatca
acccagccaggcttatcaggtattaatcttgggaagtttcttctcaagcgtgtcattgac
atgttgagaagagatatgccttcagtgcagatttttgccacccttagccctatacctggt
ttcatgcaatggcttcttgctaagttggcatcacaaataaaattagcagagacagagttg
caagaaggcaattcgttagaaggtgccagttctactttcagagagtccatccttctcccg
gaggaagagaagataatacacaatgcggtcgaacaagttaatgataaacagggaattgaa
cttttacaagatgtactgaaatcaagtcagtgggtgaagtctgacaaattatctgctgca
ctaaaatctcctcttatgcgtttgtgttcaaggtatcttgccagagagagaaagcgagga
aaagctctagatgctgtcgcaaattttcacttgcaaaatggagcaatgatcgagagaata
aactggatggccgaccaatcagagaagggcattaagcaaagtggaggtatcatggtcaat
tatctgtacaggttagagagtatagaagagtatgcactgtcttattcggctacagggctt
atccatgggtcacctggcatgtcctaa

DBGET integrated database retrieval system