KEGG   Brachypodium distachyon: 100840369Help
Entry
100840369         CDS       T01717                                 

Definition
phosphoinositide phospholipase C 6-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
bdi  Brachypodium distachyon
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bdi00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:bdi04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 586 aa AA seqDB search
MGSYAYRYCMCFTRKFRSPDAHPPPDVRAAHAAAASADEGAGLRRFLADVQREDPSEADR
ILAALAGGGGGGIARLVGRSPALPSLDDFFGFLFSPDLNPPIPDKVHQDMSAPISHYYVF
TGHNSYLTGNQLNSDSSDIPIIRALQRGVRVIELDMWPNSAKNCVEILHGGTLTAPVEII
KCLKSIKEHAFCASTYPLVITLEDHLTADLQAKVAEMITETFGDLLYVPSSDALNEFPSP
EALMKRIIISTKPPQEFREFLKAQGNQNNNGNTANLSDEGALRRLDSNADDSDGKDDLDE
EDDEESEEEDPKFQPDTACEYRKLITIHAGKPKGHLRDALKVDPDKVRRLSLSETQLTKA
TASHGADIIRFTQKNILRVYPKGTRINSSNYDPINAWTHGAQMVAFNMQGHDKSLRLMQG
FFRANGGCGYVKKPDFLLKTGPNGEVFDPKANLPVKKTLKVKVYMGDGWRMDFSKTHFDA
FSPPDFYARVGIAGVKADCVMKKTKTIEDQWVPVWDEEFTFPLTVPELALLRVEVQEYDM
SEKHDFGGQTCLPVMELKQGIRAVPLHDRKGNRYKSVRLLMRFDLI
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggggagctacgcctacaggtactgcatgtgcttcacccgcaagttccgctccccggac
gcgcacccgccgcccgacgtccgcgccgcccacgccgccgccgcttccgccgacgaagga
gccgggctccgacgcttcctcgccgacgtgcagcgggaggacccctccgaggcggaccgc
atcctcgcggccctcgccggcggcgggggcggcgggatcgcgcgcctcgtcggccgctcc
ccggccctgccctcgctcgacgacttcttcggcttcctcttctcccccgacctcaacccg
cccatccccgacaaggttcaccaggacatgtcagccccgatttctcattattatgtgttc
accggtcacaattcttacttgactgggaaccagcttaatagtgactccagtgacatccca
atcataagagcattgcagaggggcgtgagagtgattgagctcgatatgtggcccaactcc
gcaaagaactgtgttgagattctccatggagggacgctgactgcacctgtagaaatcatc
aaatgtttaaagtccattaaagaacatgccttctgtgcctctacatatcctcttgtaatt
actctagaagatcacctgactgcagatctccaagctaaagtagctgagatgatcaccgaa
acatttggggacctcctttatgtccctagttcagacgcactaaatgagtttccttctcca
gaagctctaatgaaaagaataatcatctcgactaaaccgccacaagaattcagggaattt
cttaaagctcagggtaatcagaacaacaatggcaacacagctaatttgtcagacgaagga
gccctgagaagattagattcaaatgctgatgattctgatggaaaggatgatctggatgag
gaagatgatgaagaatctgaggaagaggatcccaaatttcagccagatactgcctgtgag
tataggaaactgataaccatacatgctggcaaaccaaaaggccatttgagggatgcactt
aaggtggaccctgacaaagtcaggcgcctttctttgagcgagacacaattgactaaagca
acagcttctcatggtgctgatatcataaggttcactcagaagaatatactgagggtttat
ccaaagggtacaaggattaattcttctaattatgatccaataaatgcctggactcatggc
gctcagatggttgcatttaacatgcagggacatgacaaatcgctaaggttaatgcaagga
ttttttagagccaatgggggttgtgggtatgttaaaaagcccgacttcttgctgaagaca
ggtccgaatggcgaagtatttgatcccaaagcaaatctgcctgtgaagaaaactctgaag
gtcaaagtatacatgggagacgggtggcgcatggacttcagcaaaacccatttcgacgcc
ttttctccgcccgatttctacgccagggtagggatagcaggagtgaaggcggactgcgtg
atgaagaagacgaagacgatcgaggaccagtgggtgccggtgtgggacgaagagttcaca
ttcccgctgacggtcccggagctggccctgctgagggtggaggtgcaggagtacgacatg
tcggagaagcatgactttggcgggcagacgtgcctgccggtgatggagctgaagcaaggc
atccgcgccgtgcccctccatgatcgcaagggcaaccggtacaagtccgtcaggcttctc
atgcgcttcgacctcatctag

DBGET integrated database retrieval system