KEGG   Brachypodium distachyon: 100840484Help
Entry
100840484         CDS       T01717                                 

Definition
probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bdi  Brachypodium distachyon
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100840484
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100840484
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100840484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 168 aa AA seqDB search
MATASSATSVYDFTVKDASGKDVDLSVYKGKVLLIVNVASQCGLTNSNYTELSQVYEKYK
DQGLEILAFPCNQFAGQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGSNASPLYKFLKSS
KGGIFGDSVKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGIS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgcatcgtcggccacctccgtctacgactttaccgtcaaggatgcaagcggg
aaggacgtcgatctgagcgtctacaaggggaaggttcttctcatcgttaacgtcgcatcc
cagtgcggcttaactaactccaactacaccgagctgagccaggtttatgagaagtacaag
gaccaaggccttgagatcttggctttcccatgcaatcagtttgctgggcaggagcctggc
accaatgaggagattgtccagtttgcctgcactcgcttcaaggccgagtaccccattttt
gacaaggttgacgtcaatggcagcaatgcttcccccctgtacaagttcctgaagtctagc
aaaggcggaatttttggcgatagtgtcaaatggaacttctccaagttcttggttgacaag
gagggtcgcgttgtggaccgctatgctcccaccacttccccgctgagcattgagaaggat
atcaagaagctgcttgggatctcataa

DBGET integrated database retrieval system