KEGG   Brachypodium distachyon: 100840565Help
Entry
100840565         CDS       T01717                                 

Definition
(RefSeq) alcohol dehydrogenase 1 isoform X1
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00010  Glycolysis / Gluconeogenesis
bdi00071  Fatty acid degradation
bdi00350  Tyrosine metabolism
bdi00592  alpha-Linolenic acid metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100840565
  Lipid metabolism
   00071 Fatty acid degradation
    100840565
   00592 alpha-Linolenic acid metabolism
    100840565
  Amino acid metabolism
   00350 Tyrosine metabolism
    100840565
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100840565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C UDPG_MGDP_dh_N TrkA_N IlvN
Motif
Other DBs
NCBI-GeneID: 100840565
NCBI-ProteinID: XP_003577716
UniProt: I1IMM6
Position
4
AA seq 379 aa AA seqDB search
MATAGKVIKCKAAVAWEAAKPLKIEQVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQT
PMFPRIFGHEAGGIVESVGEGVTEVAPGDHVLPVFTGECKECPHCKSAESNMCDLLRINT
DRGVMIGDGKSRFSIDGKPIYHFVGTSTFSEYTVMHVGCVAKINPEAPLDKVCVLSCGIS
TGLGASINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGASRIIGVDLNASRFEEARKFGC
TEFVNPKDHSKPVQEVLADMTNGGVDRSVECTGNVNAMIQAFECVHDGWGVAVLVGVPHK
DAEFKTHPMNFLNERTLKGTFFGNFKPRTDLPNVVEMYMKKELEVEKFLTHSVPFSEINK
AFDLMAKGEGIRCIIRMEN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgccgggaaggtgatcaagtgtaaagcggcggtggcatgggaggcggcgaag
ccgctgaagatcgagcaggtggaggtggcgccgccgcaggccatggaggtgcgcgtcaag
atcctcttcacctcgctctgccacaccgacgtctacttctgggaggccaaggggcagact
cccatgttccctcggattttcggtcatgaagctggaggcatagtggagagtgttggagag
ggtgtgactgaggttgcccctggtgaccatgtcctcccagtgttcactggagagtgcaag
gagtgtccgcactgcaagtcggccgaaagcaacatgtgtgatctgctcaggatcaacact
gacaggggtgtcatgatcggtgatggcaaatcaaggttctctatcgacgggaagccgatt
taccatttcgtggggacttccaccttcagtgagtacactgtcatgcatgtcggttgcgtc
gcaaagatcaaccctgaggctccccttgataaagtctgtgttcttagctgtggtatttcc
actggtcttggtgcatcaatcaatgttgcaaaaccgccaaagggttcaacagtcgcgata
ttcggcctcggagctgttggtcttgctgccgcagaaggtgcgaggattgcaggagcatca
aggattattggcgttgacctgaatgccagtagattcgaggaagctagaaagtttggctgc
accgaatttgtgaaccccaaagaccacagcaagccagttcaagaggtactcgctgacatg
acaaatggtggagttgaccgcagtgtcgaatgcactggcaacgtcaacgccatgatacag
gcatttgaatgcgttcatgatggctggggtgttgctgtgctggtgggtgtgcctcacaag
gacgccgaattcaagacccacccgatgaatttcctgaacgagagaacactgaaggggacc
ttcttcggtaacttcaaaccacgcactgatctgcccaatgtcgtggagatgtacatgaag
aaggagctggaggtggagaagttcctcacgcacagcgtgcccttctcggagatcaacaag
gccttcgacctcatggcgaaaggggagggcatccgctgcatcatccgcatggagaactag

DBGET integrated database retrieval system