KEGG   Brachypodium distachyon: 100841029Help
Entry
100841029         CDS       T01717                                 

Definition
histone H2B.6-like
Orthology
K11252  
histone H2B
Organism
bdi  Brachypodium distachyon
Brite
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100841029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 147 aa AA seqDB search
MAPKAEKKPAEKKPAAEEKAPSKGEKKPKAEKRLPAAKEGGGGGVDKKAKKKAKKSVETY
KIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAAKLARYNKKPTITSREIQTS
VRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagcccgctgagaagaagccggcggcggaggagaaggcc
ccgtccaagggggagaagaagcccaaggcggagaagcggctgccggcggccaaggagggc
ggcggcggcggcgtggacaagaaggccaagaagaaggcgaagaagagcgtggagacgtac
aagatctacatcttcaaggtgctcaagcaggtgcacccggacatcggcatctcctccaag
gccatgtccatcatgaactccttcatcaacgacatcttcgagaagctcgcgcaggaggcc
gcaaagctcgccaggtacaacaagaagcccaccatcacctcccgcgagatccagacctcc
gtgcgcctcgtcctccccggcgagctcgccaagcacgccgtctccgagggcaccaaggcc
gtcaccaagttcacctcctcctag

DBGET integrated database retrieval system