KEGG   Brachypodium distachyon: 100841104Help
Entry
100841104         CDS       T01717                                 

Definition
isocitrate lyase-like
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bdi  Brachypodium distachyon
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100841104
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    100841104
Enzymes [BR:bdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     100841104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 575 aa AA seqDB search
MASPFSVPSLIMEEEGRFEAEVAEVGAWWNTERFRLTKRPYTARDVVLLRGTLRQSYASG
EMAKKLWRTLKSHQANGTASRTFGALDPVQVTMMAKHLDTIYVSGWQCSSTHTSTNEPGP
DLADYPYDTVPNKVEHLFFAQQYHDRKQQEARMSLPRAERAHAPFVDFLKPIIADGDTGF
GGATATVKLCKLFVERGAAGVHLEDQSSVTKKCGHMAGKVLVAVSEHVNRLVAARLQFDV
MGVETVLVARTDAVAATLIQTNVDARDHGFILGATNPRLKNRSLNTVLSDAMAAGKNGME
LQAIEDEWIATAQLKTFSDAVKDAIAAIPNTTDHDKNRKLQEWSNATGGYEKCISHEQAR
ELAASLGVPSLFWDWDLPRTREGFYRFRGSVAAAVVRGRAFAPHADVLWMETSSPDIAEC
TAFSEGVRGGHPETMLAYNLSPSFNWDASGMTDADMAAFIPQVARLGYVWQFITLAGFHA
DALVTDTFARDFARRGMLAYVERIQREERSNGVDTLEHQKWSGANFYDRVLKTVQGGISS
TAAMGKGATEEQFKGSWARPGSESSGQHVLAKSRM
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgccattctccgtgccttcgttgattatggaggaggaaggtcggttcgaggcg
gaggtggccgaggtcggggcgtggtggaacacggagaggttccggctgaccaagcgcccc
tacaccgcccgcgacgtcgtgctcctccgcggcacgctccggcagagctacgcctcgggc
gaaatggccaagaagctctggcgcacgctcaagtcccaccaggccaacggcacggcctct
cgcaccttcggcgccctcgaccccgtccaggtgacgatgatggccaagcacctggacacc
atctacgtgtccgggtggcagtgctcgtcgacgcacacctcgacgaacgagccgggcccg
gacctggccgactacccctacgacacggtgcccaacaaggtcgaacacctcttcttcgcc
cagcagtaccacgaccggaagcagcaggaggcgcgcatgtcgctgccccgcgccgagcgc
gcccacgcgccgttcgtggacttcctcaagcccatcatcgccgacggcgacacgggcttc
ggcggcgccacggcaacggtcaagctgtgcaagctcttcgtggagcgcggcgcggccggg
gtgcacctggaggaccagtcgtccgtgaccaagaagtgcggccacatggccgggaaggtg
ctcgtggccgtgtcggagcacgtgaaccgcctcgtcgccgcccggctccagttcgacgtc
atgggcgtcgagaccgtcctcgtggcgcgcaccgacgccgtggccgccacgctgatccag
accaacgtggacgcgcgcgaccacggcttcatcctcggggctaccaacccgcggctcaag
aaccggagcctcaacaccgtgctctcggacgccatggcggccggcaagaacggcatggag
ctccaggccatcgaggacgagtggatcgccacggcgcagctcaagaccttctccgatgcc
gtcaaggacgccatcgccgcaatccccaacaccaccgaccacgacaagaaccgcaagctc
caggaatggagcaacgccacgggcggctacgagaaatgcatttcccacgagcaagcgcgg
gagctcgccgcgagcctgggagtgccttcgttgttctgggactgggacctgccgcggacc
agggaagggttctaccgcttccgggggtccgtggcggcggccgtggtccgcgggcgcgca
ttcgcgccgcacgcggacgtgctctggatggagacgtcgagcccggacatcgccgagtgc
acggccttctcggagggcgtgcgcggggggcacccggagacgatgctggcgtacaacctc
tcgccgtccttcaactgggacgcgtccggcatgacggacgccgacatggccgccttcatc
ccgcaggtggccaggctggggtacgtgtggcagttcatcacgctcgccgggttccacgcc
gacgcgctcgtcaccgacacgtttgcgagggactttgcccgccgcggcatgctcgcctac
gtggagaggatccagagggaggagaggagcaatggggtggacacgctggagcatcagaag
tggtcgggcgccaacttttatgacagggtgctcaagaccgtccagggcggcatctcctcg
acagcagccatgggcaaaggagctactgaagaacagttcaagggctcatgggctaggccc
ggaagtgagagcagtggccaacacgttcttgccaaatccaggatgtga

DBGET integrated database retrieval system