KEGG   Brachypodium distachyon: 100841343Help
Entry
100841343         CDS       T01717                                 

Definition
beta-amylase 1, chloroplastic-like
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
bdi  Brachypodium distachyon
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bdi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 534 aa AA seqDB search
MAFNLAQSAVAASSFAPSTARRVAAPRRKAASQVPPIGLRLQRRLAACEPSRMSSTACRA
SARSSGVPVFVMLPLDTVKQCGSGLKRRKAMAASLAALKSAGVEGVMVDVWWGTVESEGP
GRYNFAGYMELMEMARDTGLKVQAVMSFHKCGGNVGDSVTIPLPRWVTEEMDKDQDLAYT
DQWERRNYEYVSLGCDAVPVLNGRAPVQCYTDFMRAFRDHFTRFLGNTIVEIQVGLGPAG
ELRFPSYPESNGTWRFPGIGAFQCYNRYMLSSLKSAAEAAGKPEWGISGPTDAGEYNSWP
EDTLFFRQDGGGWGCEYGEFFMSWYSQMLLDHGDRVLSGAASVFSASASPDVDDIRLSAK
VSGIHWHYGTRSHAPELTAGYYNTGDRDGYRPVARMLARHGAVLNFTCVEMRDREQPREA
RCMPEALVRQVAAAARDAGVGLAGENALPRYDGAAHDQVVATAAERAEEDRMVAFTYLRM
GPDLFQPDNWRRFAAFVNRMSKSGSCREAAEREAHGVAHATGALVHEAAVALRD
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcctttaacttggctcagagtgccgtggcggcatcgtccttcgcgccctccactgcg
cgccgcgtcgccgcgccgaggaggaaggcagcgtcccaggtgccgccgatcggcctgagg
ctgcagaggcggctagcggcgtgcgagccgtcgaggatgtcatcgacggcgtgccgggcg
tcagcgaggagttccggggtgccggtgttcgtgatgttgccgctggacaccgtgaagcag
tgcgggagcgggctgaagcgcaggaaggccatggcggccagccttgcggcgctcaagagc
gcgggcgtggagggcgtcatggtggacgtgtggtggggcaccgtggagagcgagggcccc
gggaggtacaacttcgccgggtacatggagctcatggagatggcgcgcgacaccgggctc
aaggtccaggccgtcatgtccttccacaagtgcggcggcaacgttggcgactccgtcacc
atcccactgccgaggtgggtaacggaggagatggacaaggaccaggaccttgcctacacc
gaccaatgggagcgccgcaactacgagtacgtctcgctcggctgcgacgccgtgcccgtg
ctcaacggccgcgcccccgtccagtgctacaccgacttcatgcgcgccttccgcgaccac
ttcactcgcttcctcggcaacaccatcgttgaaatccaagtcggcctgggcccagcaggt
gagctgcgcttcccttcctacccggagagcaacggcacctggaggttccccggcatcggc
gctttccaatgctacaacaggtacatgcttagcagcctcaagagtgcggcggaggcggcg
ggcaagccggagtggggcatcagcgggccgacggacgccggcgagtacaacagctggccg
gaggacacgctcttcttccgccaagacggcggcggctggggctgcgagtacggcgagttc
ttcatgtcgtggtactcccagatgctcctcgaccacggggaccgcgtcctgtcgggcgcc
gcgtccgtcttctccgcgtccgcctcccccgacgtcgacgacatccgcctctccgccaag
gtgtccggcatccactggcactacggcacccggtcccacgcgccggagctcacggccggg
tactacaacaccggggaccgcgacgggtaccggcccgtggcgcgcatgctggcccggcac
ggcgccgtgcttaacttcacctgcgtggagatgcgggaccgcgagcagccgcgggaggcg
cggtgcatgcccgaggcgctggtgcggcaggtggcggccgcggcccgggacgccggggtg
ggcctggccggcgagaacgcgctgccgcggtacgacggcgcggcccacgaccaggtcgtg
gccacggcggccgagcgcgccgaggaggaccgcatggtggccttcacgtacctccgcatg
gggcccgacctgttccagcccgacaactggcgtcggttcgcggcgttcgtgaaccggatg
tccaagtccgggtcctgcagggaggccgccgagcgggaggcgcacggcgtcgcgcacgcc
accggggcgctcgtgcacgaggccgccgttgcgctgcgggactga

DBGET integrated database retrieval system