KEGG   Brachypodium distachyon: 100841379Help
Entry
100841379         CDS       T01717                                 

Definition
(RefSeq) lecithin-cholesterol acyltransferase-like 1
  KO
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
bdi  Brachypodium distachyon
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100841379
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100841379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 443 aa AA seqDB search
MERRPSLVAMVVVAMLSLSSCCCCASSSAGGGQQLHPVILIPGSGGNQLEAKLTEEYSPS
SLACRVWPLVRGRGGWFRLWFDPSVLVAPLTRCFAERMMLYYDIAADDYRNAPGVETRVS
DFGSTSSLRYLDPNLKLLTGYMDALASTLEKAAGYEEGRDLFGAPYDFRYGLAAPGHPSQ
AGSAYLERLRLLVESACAANGGKPAILLAHSLGGLYALQLLARSPAPWRAAHVKRLVTLS
APWGGSVQEMLTFASGNTLGVPFVDASIIRDEQRSSESNLWLLPTPKVFGNTTLVVSEFH
NRSYSAKNVTQFLRDIGFEGGVEPYRARIRPLGEALPEPGVPVTCLVGTGVDTVESLVFG
KEGFEAGPVKVAYGDGDGTVNLASLVGPIKAWADSPAQVLEVVELPGVSHSGILKDKSAL
QQIVRIVDAINLNTTGSNYLRSF
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggagagacgcccatcactagtagccatggtcgtggtggccatgctgtcgctgagctcg
tgctgctgctgcgcgtcgtcgtccgcgggcggcgggcagcagctgcacccggtgatactg
atcccggggtccggcggcaaccaactggaggcgaagctgacggaggagtacagcccgtcg
agcctggcgtgccgggtgtggccgctggtgcgcggccggggcggctggttccgcctgtgg
ttcgacccctccgtcctggttgcgcccctcacccggtgcttcgccgagcgcatgatgctc
tactacgacatcgccgccgacgactaccgcaacgcgccgggcgtcgagacccgggtctcc
gacttcggctccacctcctccctccgctacctcgacccaaacctcaagctgctgacgggg
tacatggacgcgctggcgagcacgctggagaaggcggcagggtacgaggaagggcgggac
ctgttcggcgcgccgtacgacttccgttacggtctcgccgcgccggggcacccgtcgcag
gccggcagcgcgtacctggaacgcctcaggcttctggtagaatccgcgtgcgcggccaac
ggcggcaaacccgcgatcctgctagcgcacagcctgggcgggctctacgcgctgcagctc
ctagcgcgcagcccggccccctggcgggccgcgcacgtgaagcggctggtgacgctgtcg
gcgccctggggcggctccgtgcaggagatgctcaccttcgcgtccgggaacacgctgggc
gtgccgttcgtggacgcgtccatcatccgcgacgagcagcggagctccgagagcaacctc
tggctgctgcccacgccgaaggtgttcggcaacacgacgctcgtggtgtccgagttccac
aaccggtcctactcggccaagaacgtaacgcagttcctgcgggacatcgggttcgagggc
ggcgtggagccctacagggccaggatacggccgctcggggaagccctgccggagcccggg
gtgcccgtcacgtgcctcgtgggcaccggcgtggacaccgtggagagcctcgtgtttggg
aaggaagggttcgaggccggcccggtgaaagtggcgtatggggatggggatgggacggtg
aaccttgctagccttgtcgggccgatcaaggcgtgggctgactcgccggcgcaggtgctc
gaggttgtggagctgcccggggtgtcgcactcgggcatcctcaaggacaagagcgcgctc
cagcagatcgtcaggattgtcgatgccatcaatctcaacaccacgggctcgaactatctg
cggtcgttttaa

DBGET integrated database retrieval system