KEGG   Brachypodium distachyon: 100841615Help
Entry
100841615         CDS       T01717                                 

Definition
1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bdi  Brachypodium distachyon
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100841615
Enzymes [BR:bdi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100841615
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100841615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 829 aa AA seqDB search
MLCLACSRSPLPRPSPTDRPGPGIAGVAGGGNVRLSVVPVPSPPLRCSWPRKAKSKFSVP
VAVRENQNMAMKEDGFDNLPIYKLDPKLAEFKVHFDYRIKRYLEQKQSIEQNEGSLAEFS
KGYLKFGINTDGDTTVYREWAPAAKEAQLVGDFNNWNGAMHKMERDKYGVWSIRISHVNG
KPAIPHNSKVKFCFRRGDGVWVDRIPAWIRYATFDASKFGAPYDGIHWDPPTSERYVFKH
PRPPKPGAPRIYEAHVGMSGEKPEVSTYREFADNVLPRIRANNYNTVQLMAIMEHSYYAS
FGYHVTNFFAVSSRSGTPEDLKYLVDKAHSLGLRVLMDVVHSHASSNVTDGLHGYDVGQN
TQESYFHTGERGYHKLWDSRLFNYANWEVLRFLLSNLRYWMDEFMFDGFRFDGVTSMLYN
HHGINMSFAGNYKEYFGLDTDVDAVVYMMLANHLMHKLLPEATVVAEDVSGMPVLCRPVD
EGGVGFDYRLAMAIPDRWIDYLKNKDDLEWSMSGIALTLTNRRYTEKCIAYAESHDQSIV
GDKTMAFLLMDKEMYTGMSDLQPASPTIDRGIALQKMIHFITMALGGDGYLNFMGNEFGH
PEWIDFAREGNNWSYDKCRRQWSLVDTDHLRYKYMNAFDQAMNALDDKFSFLSSSKQIVS
DVNEEKKVIVFERGDLVFVFNFHPNKTYEGYKVGCDLPGKYRVALDSDAFLFGGHGRVGH
DIDHFTSPEGVPGVAKTNFNNRPNSFKVLSPPRTCVVYKRADEKAEVHKMEGAAASGKIA
LDYIGVDATYIKQIADKEAASGSRKASTEDDSGKKGTKFALQSSVEDKK
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcctcgcctgctcgcgctctcccctgccgcgcccctctcccactgaccgcccg
ggccccgggatcgcgggtgtcgccggcggcggcaatgtgcggctgagcgtggtgcctgtc
ccgtctccgccgcttcgctgctcgtggccacggaaggccaagagcaagttctctgttcct
gtggctgtgcgagaaaaccaaaatatggcaatgaaggaagatggtttcgataaccttccc
atatataagctggatccgaagttggccgaattcaaggtccacttcgattacaggataaaa
agataccttgaacagaaacaatcgattgaacaaaatgagggaagccttgccgaattttct
aaaggctatttgaagtttgggatcaatacagatggtgacacaactgtgtaccgtgagtgg
gcccctgctgcaaaggaagcgcaacttgttggtgacttcaacaactggaatggtgctatg
cacaagatggagagggataaatatggtgtttggtcaatcaggatttcccatgtcaatggg
aaacctgccatcccacacaattccaaggttaaattttgctttaggcgtggagatggtgta
tgggttgatcggattcctgcatggattcgttatgcaacgtttgatgcctctaaatttgga
gctccttacgacggcattcactgggatccaccaactagtgaaaggtatgtgtttaagcat
cctcggcctccaaagcctggcgctccacgtatctatgaggcgcatgtggggatgagtggt
gaaaagccagaagtaagcacatacagagaatttgcagacaatgtgttaccacgcataagg
gcaaataactacaacacagttcagctgatggcaatcatggaacactcctactatgcttct
tttgggtatcatgtgacaaatttcttcgcagttagcagcagatcaggcacgccagaggac
ctcaaatatcttgttgacaaggcacatagtttaggattgcgtgttctgatggatgttgtc
catagccatgcgagcagtaatgtgacggatggtctacatggctatgatgttggacaaaac
acacaggaatcgtatttccacacaggagagaggggctatcacaaactgtgggatagccgt
ctgttcaactatgccaattgggaggtattaagatttcttctttctaatttgagatattgg
atggatgaattcatgttcgatggcttccgatttgacggggttacatccatgctatacaat
caccatggtatcaatatgtcatttgctgggaattacaaggagtattttgggttggatact
gatgtagatgcagttgtttacatgatgcttgccaaccatttaatgcacaagctcttgcca
gaagcaactgttgttgcagaagatgtttcaggcatgcctgtgctttgtcggccagttgat
gaaggtggagtagggtttgactatcgcctggctatggctattcctgatagatggattgac
tacttgaagaacaaagatgacctcgagtggtcaatgagtggaatagcactgactttgact
aacaggagatatactgaaaagtgcattgcatatgctgagagccacgatcagtctattgtt
ggtgacaagactatggcatttctcttgatggacaaggaaatgtatactggcatgtcagac
ttacagcctgcttcgcctacaattgatcgtggcattgcacttcaaaagatgattcacttc
atcacaatggctcttggaggtgatggctacttaaattttatgggaaatgagtttggtcac
ccagaatggattgactttgcaagagaaggcaacaactggagttatgataaatgcagacgt
cagtggagccttgttgacactgatcacctacgatacaagtacatgaatgcatttgatcaa
gcaatgaatgcgctcgatgataaattttctttcctgtcatcgtcaaagcagattgtcagc
gacgtgaatgaggagaaaaaggttattgtctttgaacgtggagatttggttttcgtcttc
aactttcatcctaataaaacttatgagggttacaaagtcggatgcgacttgcctgggaag
tacagggtagctctggactctgatgctttcctctttggtggacatggaagagttggccat
gacatagatcacttcacgtcaccggaaggagtaccaggagtagccaagacaaacttcaac
aaccgccctaactcattcaaagtcctctccccaccccgtacttgtgtggtttacaagcgc
gccgatgaaaaagctgaagtgcataagatggaaggagctgctgcttctgggaagattgct
ctggattatatcggtgttgacgcgacatacataaaacaaatagcagacaaggaggcagca
tctggttccagaaaggcgtcaacagaggatgattcaggcaagaagggaaccaagtttgcc
cttcagtcgtctgtcgaggacaagaaataa

DBGET integrated database retrieval system