KEGG   Brachypodium distachyon: 100841616Help
Entry
100841616         CDS       T01717                                 

Gene name
MPK7-1
Definition
(RefSeq) mitogen-activated protein kinase 4-like
  KO
K20535  
mitogen-activated protein kinase 1/2 [EC:2.7.11.24]
Organism
bdi  Brachypodium distachyon
Pathway
MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    100841616 (MPK7-1)
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100841616 (MPK7-1)
Protein kinases [BR:bdi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100841616 (MPK7-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 413 aa AA seqDB search
MPSRFPFLSPGCFIRLLSGSASSDLLLLLPRRGQSAPRARVLLKMAMMVDPPNGTGNHGK
HYYTMWQTMFEIDTKYVPIKPIGRGAYGIVCSSTNQENNEKVAIKKINNVFDNRVDALRT
LRELKLLRHLRHENVIALKDIMMPVHRRSFKDVYLVSELMDTDLHQIIKSSQPLSNDHCQ
YFLFQLLRGLKYLHSAGILHRDLKPGNLLVNANCDLKICDFGLARTNNTKGQFMTEYVVT
RWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECLNQLKLIVNVLGTMSEN
DLEFIDNPKARKYIKSLPYTPGTPLTSMYPQAHPLAIDLLQKMLVFDPSKRISVTEALEH
PYMSPLYDPSANPPAQVPIDLDIDENLGVEMIREMLWQEMLQYHPEAARMVNM
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcgcttccccttcctttccccgggctgcttcatccgcttgctctccggttcg
gcctcttcagatctgctgctgctgctgccaaggcgaggccagtcggcgccgcgtgcccgc
gtactgttgaaaatggcgatgatggtggatcctcctaatggcacgggaaaccatgggaag
cactactacacgatgtggcaaaccatgtttgagatcgacaccaagtacgtgccgatcaag
cccatcggaagaggagcttatgggatagtttgctcctctacaaatcaggagaacaacgag
aaggttgcgataaaaaagataaacaatgtctttgacaaccgcgtggatgcactgaggacg
ctgcgggagttgaaactccttcggcacttgcgtcatgagaatgttattgctttgaaggac
ataatgatgcctgtacataggaggagcttcaaggatgtttacttggtctctgaacttatg
gatactgatctgcatcagataatcaagtcatctcaaccgctttccaatgaccactgccaa
tatttcctttttcagctactccgaggtctgaagtaccttcattcagcagggatactccat
agagacctgaagccagggaaccttctggttaatgcaaactgtgatctgaaaatctgtgat
tttggtctggctcgcacaaataacaccaaaggtcagtttatgactgaatatgttgtcacc
cgctggtacagagctcctgagctgctgctctgttgcgacaactatggcacgtccatagat
gtctggtctgttggctgcatctttgctgagctacttggccgcaagccgattttcccagga
accgagtgcctcaatcagcttaagcttatagttaatgtccttggcaccatgagtgagaat
gaccttgagttcattgacaacccgaaagctcgcaagtacatcaaatcccttccatacacc
ccaggcactcccctcactagtatgtacccacaagcacatcctcttgccattgatctgttg
cagaagatgcttgtcttcgatccttccaaaaggattagtgtcactgaggctctggagcac
ccctacatgtctcctctgtatgacccaagtgcgaaccctcctgctcaggtgcccatcgat
cttgatatagacgaaaacctcggcgtggagatgatcagagaaatgttgtggcaggagatg
ctacagtaccaccctgaggctgccagaatggtgaatatgtga

DBGET integrated database retrieval system