KEGG   Brachypodium distachyon: 100841955Help
Entry
100841955         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase 15-like
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 971 aa AA seqDB search
MLQPREADVPALFVVFIVLPVIAYFLLGRWHDAVSKKARVGVLAQKAAEEDFKVETMACP
DVVLPGPSLRPMPYLRSVPSFRPEYHECATCHGPAKTRCSRCKSVRYCSGKCQIIHWRQG
HKQTCQLWHVNGGSNSGLLPNTEGSEQMPFLSNLNSPLPGGDNHLHDLNFDTVSEPSFAT
TDSYTLGTDAFPTEKSNQNPHSSENGASVASSEKCNHSVDDETRSSEIASANKVSNNSFG
CSDGKNGNPDSTYLHNGMVQHPNSCAPETRKRPKASITVYEPDMGVYLTSDMISSCEGPY
ASATESLQRSNSSGKATGKGNMVHKKPPYPSGKVASSQKSQEVSTSYQYDDHEKNPYSKS
DQRFTKPSVSTSNNLQGSNGTSKLGISKVDVLRKPSKFLKTSLVGLINDNKRSKVLFRYE
DLVKFFQYEVRGISPRGLFNCGNSCYANAVLQCLMCTKPLMIYLLLRLHSKDCSKNGCLM
CELEQYASTLRESGGPVSPSRILSNLRNIGCRLGGGSQEDAHEFLRHLVMSMQAACLDGL
GGEKHVEPSLQETTLIQQMFGGRLKSKVKCLRCLHESERYENIMDLTLEIHGWVESLQDA
LTQFTAPEDLDGENMYKCGRCCAYVKARKQLSVHEVPNILTVVLKRFQTGKYGKINKCVT
FPEMLDMVPFVTGAGDHPPLYFLYAVVVHVDTENASFSGHYISYVKDMQGTWLRIDDSEV
KAVSPNQVMSEGAYMLFYLRSFPRPPRIYIEKGLLPVTSSAKRHSSKSSKGSKEEQKLAE
SLFASNDKICGVYDFRPDEEGYRQDQHAELRPRNFYHTDDAFAESVSTDFSDATSSEWSL
FTSSDESSFTTESTRDSFSVVDYSDNAGLDPITSIFGPYYAPDHPPGNFASCTRFSPSNP
ETRYFSESTGFVSDSSSLPTHPYGNVHRGRYPDRACASSAEPLASANQRSVYGRYGHSRD
GFVQTSGFCHM
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atgctccaaccaagggaagctgatgtgcctgcactctttgttgtatttatcgtacttccg
gtgatagcatattttcttcttgggagatggcatgatgctgtaagtaagaaggcaagggta
ggtgtgcttgcccagaaagctgcagaagaagactttaaagtggaaacaatggcgtgtcca
gatgttgtattgccaggaccttctttgagacccatgccgtatttgagatctgtaccttct
tttagacctgaataccatgagtgtgctacttgccatggtcctgcaaagacccggtgctcg
agatgcaagtctgttagatactgctctggtaagtgtcaaataatacactggaggcaaggg
cataagcaaacatgccagctatggcatgttaacggtggtagcaactctggcttactacct
aatacggagggttctgaacagatgccattcttgagtaacctgaattcacctcttccaggg
ggtgacaatcacctgcatgacctgaattttgatactgtatcagagccgtcctttgcgaca
actgatagctatactctaggtactgatgcatttcccacagaaaaatcaaaccaaaatccg
cattcaagtgaaaatggtgcttctgttgcctcttctgaaaagtgcaaccacagtgttgat
gacgaaacccgctcatctgaaattgcatcagcaaataaggtttcaaacaacagttttggt
tgttcagatgggaagaatgggaaccctgattcaacttatctccacaatggtatggtacaa
catcccaatagttgtgctcctgaaacaagaaaacgacctaaagcaagcatcacggtttat
gaacccgacatgggtgtctatttaacttctgatatgatcagttcttgtgaggggccatat
gcttctgcgacagagtcactacagaggagcaactcatctggaaaagctactggaaaagga
aacatggtgcacaagaagcctccttatccatcaggcaaggtggcttcatcacaaaaatca
caggaagtgtcaacgtcatatcaatatgatgaccatgaaaagaatccttacagcaaaagt
gatcaaagatttaccaaaccaagtgtctcgacaagcaacaatttacaaggaagcaatgga
acctcaaagttaggaatatccaaagttgatgttctgaggaagccctcaaaatttctaaaa
accagcctggtgggtttaatcaatgataataagaggagcaaggtattgtttaggtatgag
gatcttgttaagttctttcagtatgaagtacggggcatttctcccagaggacttttcaat
tgtgggaacagctgctatgctaatgctgttctacaatgtctgatgtgcacaaaacccctg
atgatctacctgcttttgagattgcattctaaagactgttcaaagaacgggtgtcttatg
tgtgaacttgagcaatatgcttcaacattacgtgaaagtggcggacccgtgtctccaagt
agaatcctttctaatctgaggaatattggatgtcgcttgggtggtggaagtcaggaagat
gctcatgaatttttaaggcatcttgtgatgtctatgcaagcagcatgtttggatggatta
ggtggtgagaagcacgtagaaccaagcttgcaggaaactacactgatacaacagatgttt
ggtggccgccttaaatctaaggttaagtgcctcagatgccttcacgagtctgaaagatat
gagaatataatggatcttacattggagattcatggttgggtggagtctttgcaagatgct
ttgacacaattcactgctcctgaagatttagacggggagaatatgtataaatgtggaagg
tgctgtgcttatgtcaaagcaagaaaacaactaagcgtgcatgaggtgccgaatatatta
acagtagttttgaaaagattccagacaggaaagtacggcaagattaacaaatgtgtcact
ttccctgaaatgttggacatggttccttttgtcactggggctggtgatcacccccctctt
tacttcttatacgctgtggtcgtacatgtggatacagaaaatgcatcattctctggtcat
tacatttcatatgtcaaagatatgcagggcacatggttgagaattgatgactcggaggtc
aaggctgtatcaccgaatcaagttatgtcagaaggtgcctatatgctattctacttgaga
tctttccctcgcccaccaaggatatacattgaaaaaggcctattgcctgttacatcatcc
gcaaagcgccactcatcaaaatcctccaagggctctaaagaagagcagaagctggcagaa
tcactatttgcttccaatgataaaatatgcggtgtctatgattttagaccagacgaggaa
ggctacaggcaagatcagcatgctgagttgaggccaagaaatttttatcataccgatgat
gcttttgcagaatcggttagcacagacttctcggatgctacatcaagcgaatggtcactg
tttacgagctctgatgaatcctcgtttaccactgaaagcactagagattcattcagtgtt
gtggattacagtgacaatgctggccttgatccaattacttctatattcgggccatattat
gctccggaccatcctcctggcaattttgcctcatgtacaaggttctcaccttccaatcca
gaaacaagatacttttctgagagcacaggctttgtctcagattcctcctccttgccaact
catccctacggcaatgtacatagaggaagatatccagacagggcttgcgcatcttcagct
gaacctcttgcttcagcaaaccagcgaagcgtgtatggtaggtatggccatagtagagat
ggttttgtgcaaacatctggattttgtcacatgtaa

DBGET integrated database retrieval system