KEGG   Brachypodium distachyon: 100841966Help
Entry
100841966         CDS       T01717                                 

Definition
1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bdi  Brachypodium distachyon
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100841966
Enzymes [BR:bdi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100841966
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100841966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 835 aa AA seqDB search
MMASPAFAVVSGAGLGGAPAPPRSGAADRRRRGLQLPLLFGRDKGSCFPHAIRVASSGRR
VVMRVGGVSGEVTIPDGKSDGMLSSDGSAQFQSDDLEVPSIDDELSIEGGNEGNIESSET
DQGTEESNVEGMNKMAKESAAGEKLRVIPPPGNGEQIYEIDPTLKAYKYHLEYRYSLYRR
VRSDIDQHEGGMDAFSRGYENFGFNRSAEGITYREWAPGALSAALVGDFNNWDPNADRMS
KNDFGIWEIFLPNNADGSTPIPHGSRVKVRMDTPSGIKDSIPAWIKYSVQAPGDIPYNGI
YYDPPEDEKYVFKHPQPKRPKSLRIYETHVGMSSPEPKINTYANFRDEVLPRIKKLGYNA
VQIMAIQEHSYYGSFGYHVTNFFAPSSRFGTPEDLKSLIDRAHELGLVVLMDVVHSHASS
NTLDGLNGFDGTDTHYFHGGARGHHWMWDSRVFNYGNWEVIRYLLSNARWWLEEYKFDGF
RFDGVTSMMYTHHGLQVTFSGDYNEYFGFNTDVDAVVYLMLVNDLIHGLYPEAITIGEDV
SGMPTFALPVQVGGVGFDYRLHMAVADKWIELFKRSDESWQMGDIVHTLTNRRWLEKCVT
YAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPNIDRGIALHKMIRLITMGLGGEGY
LNFMGNEFGHPEWIDFPRGPQVLPSGKFIPGNNNSYDKCRRRFDLGDAEFLRYHGMQLFD
EAMQHLEEKYGYMTSGHQYISRKHEEDKVIVFEKGELVFVFNFHCSNSYFDYRVGCLKPG
KYKVVLDSDAGVFGGFGRIHHTADHFTSDCQHDNRPHSFSVYTPSRTCVVYAPMN
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttcgccggcgtttgcggttgtttccggggcgggtctcggcggggcaccggct
cctcctcgatccggcgccgccgaccggaggaggcgcgggcttcagctgcctctgctcttc
ggccgcgacaagggctcctgtttccctcatgccatccgcgtcgcaagttccgggaggcgc
gtcgtcatgcgcgtggggggcgtgtccggggaggtgacgatccctgacggcaagagtgac
ggaatgctgtcttctgatggttccgctcagttccagtctgatgatttggaggtaccatcc
atcgatgatgaattaagcatagagggtggaaatgaaggtaatattgaatcttcagaaaca
gatcagggtactgaagaaagtaatgtcgaaggcatgaacaaaatggccaaagaatcagct
gccggggagaaactacgtgttatcccaccaccaggaaatggagagcaaatatatgagatt
gacccaactctgaaagcgtataaataccatcttgagtatcgatacagcctatataggaga
gtacgttcagatattgaccaacacgaaggaggcatggatgcattttcccgcggttatgag
aactttggatttaatcgcagcgctgaaggcatcacttaccgagaatgggctcctggagca
ctttctgctgcgttagtaggcgacttcaacaattgggatcctaatgcagaccgtatgagc
aaaaatgacttcggcatttgggagatttttctgcctaacaatgcagatggttcgacacca
attcctcatggctcacgtgtaaaggtgcgaatggatactccatctgggataaaggattca
attccggcctggatcaagtattctgtgcaggccccaggagacataccatacaatgggatc
tattatgatcctcctgaagatgagaagtacgtattcaagcatcctcaacctaaacgacca
aagtcattgcggatatatgaaacacatgttggaatgagtagcccggaacctaagatcaac
acatatgcaaacttcagggatgaggtgcttccaaggataaaaaaacttggatacaatgca
gtacagataatggcaatccaagagcactcatattatggaagctttgggtaccatgttacc
aatttctttgcaccaagtagccgttttgggaccccagaagatttaaaatctttaattgat
agagctcatgaacttggtttggttgtcctcatggatgttgtccacagtcatgcgtcaagt
aacaccctggatgggttgaatggttttgatggcactgatacacattactttcatggtggt
gcacggggccatcattggatgtgggattctcgcgtgttcaattacgggaattgggaagtc
ataagatatctactttccaatgcaagatggtggctagaggaatataagtttgatggtttc
cgattcgatggtgtgacctccatgatgtatactcaccatggattacaagtaacgttttca
ggggactacaacgaatattttggctttaacaccgatgtagatgcagtcgtttacttgatg
ctggtaaatgatctaattcacgggctctatcctgaggccataactattggtgaagatgtt
agtggaatgcctacatttgcccttcctgttcaagttggtggggttggttttgactatcgt
ctgcatatggctgtcgctgacaaatggattgaacttttcaaacgaagtgatgaatcttgg
cagatgggtgacattgtgcacacactaacaaataggaggtggctagaaaagtgtgttact
tatgctgaaagtcatgaccaagcactagttggtgacaagactattgcattctggttgatg
gacaaggatatgtatgatttcatggctctggatagaccttcaacacctaacattgatcgt
ggaatagcattgcacaaaatgataagacttatcacgatgggtttaggaggagagggctat
cttaacttcatggggaatgagttcggacatccagaatggatagattttccaagaggccca
caagtacttccaagtggtaagttcatcccagggaacaacaacagttatgacaaatgccgt
cgaagatttgacctgggtgatgcagaatttcttaggtatcatggtatgcaactgtttgat
gaggccatgcagcatctcgaggagaaatatggatatatgacatcgggccaccagtacatt
tctcggaaacacgaggaggataaggttattgtgtttgaaaaaggagagttagtatttgtg
ttcaacttccattgcagtaacagctatttcgactaccgtgtgggttgtttaaagcctggg
aagtacaaggtggtcttagattcggacgctggagtctttggtgggtttggtaggatccat
cacacggcagaccattttacttccgactgtcaacatgacaacaggccccattcgttctca
gtgtacactcccagcagaacttgtgttgtttatgctccaatgaactga

DBGET integrated database retrieval system