KEGG   Brachypodium distachyon: 100842178Help
Entry
100842178         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase 26-like
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100842178
Peptidases [BR:bdi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100842178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1074 aa AA seqDB search
MSRHNTRNKNKRPRADESASPSYAVLKKIHSTGTITEGDIRQLYSVWKPVCQGCHGNTKD
SPNCFCGLVPNANGARKTGLWQKNSEHVRSLGPNPSADLRDSMETPAGLTNLGATCYANS
ILQCLYMNTYFRSGIFSLEPDILKKHPVIDQLARLFVQLHSSKMAFIDSAPFIKTLELDN
GVQQDSHEFLTLFLSLLERSLSHSKVSGAKTIVQHLFRGSVSHVTRCSSCGRDSEASSKM
EDFYELELNIKGLNNLEESLDDYLSVEALNGENQYSCESCQKRVDATRCIKLRSLPPVVN
FQLKRYVFLPKTTTKKKISSAFSFPAQLDMGKRLSNPSSSYTYDLAAILIHKGSAANSGH
YVAHIKDESSCQWWEFDDECVSKLGFHPFGEKPSKSSDKVDQKSEVTSSEGSVANGNKSS
YHEAKPSCTMGPMFSSTDAYMLMYKRSSKDENGTESNNIMEANNSSLPRHFADEINELNA
LYVKECEEYESKKDKLLASIQERRDEVRAVLTEAPAPPDDDSYFWISADWLRQWADNANP
PSSIDNSPIQCEHGKVPASKVTSMKRLSAKAWQKLLSKYGGGPVLSRNDVCMECLKDGAK
TAVSADVYRDRKASLKNLAEAALAGIIPEGPSYFVSKTWLTHWLRRKNADIPSDPDNVPT
SALRCSHGDLLPEHAPGAKRVSVPESLWLFLYETVNAREADNIATFPSDCQPCEICGEKL
SVVASVEDNLRAIKLKQRQRHEKLISGKGFALHPGQKYYLVPSSWLSEWRTYITATGKNV
SSLPEPQSLEVVINSLKCEKHSRLLQRPLDLVCKRGNITQKTSNTDGLAIISESDWILFS
EEWNITHGNGASAEIICSNSSQDKLHGSSEAMIILDEDPDQSINDANNSLEDSSPYIRTD
PEVCEECIGEIESCALVQKLNYQNEDIHVYLVRGKEAPKSIREACPALPIPDRRTTKRSR
RTTSGNSINLKVSGSTSVYQLKLMIWESLGIVKENQKLHKGSVEIEDDLATLADKAIFPG
DVLWVKDSEMFENRDIADEISEQKADVSAEEGFRGTLLTSSVSTQLCQDIALSE
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcacaacacacgcaataagaacaagaggccgcgggccgatgagtccgcgagc
ccgtcctatgctgttctgaagaagatacattccacgggcacgatcacggaaggcgatatc
cggcagctttatagcgtgtggaagccggtttgccagggctgccatgggaataccaaggac
tcgcccaattgtttctgtggtttggtccccaatgccaatggagcgaggaagactggcctg
tggcagaaaaatagcgagcatgtccgtagcctcggtcctaacccgtctgccgacctccgt
gattccatggagacgcctgctggattgactaatctaggcgcgacatgttatgcaaacagc
atactgcagtgcctctatatgaatacttacttccgttcgggcattttctctctggagcca
gacatcttgaagaagcaccctgttattgatcagctggctcggttatttgtgcagctacac
tccagcaaaatggctttcattgattcagcaccttttatcaagacattggaactagacaac
ggcgtccagcaggacagtcatgaatttctcaccttgtttttgtctctgctcgagcgttca
ttaagccactccaaagtctccggtgctaaaactattgtgcaacatttgttccgcgggagt
gtgtcacatgtgactcggtgctcatcatgtggaagggattctgaagcatcttcaaagatg
gaagacttctatgaactggagctaaacattaaaggtctaaataatttagaagaaagtttg
gatgactacttgagtgtggaggcactgaacggggagaaccagtactcctgtgagtcatgt
cagaaaagggtagatgcgactcgttgtataaaacttcgttcgcttcctcctgttgttaat
tttcagctcaagcgttatgtattcctaccaaagacaacaacaaagaaaaagatctcttca
gcattcagttttccggcacaactagatatgggaaagcggttatcaaacccttcatctagt
tacacttatgatctggctgctattttgattcacaagggtagtgctgctaatagtgggcac
tatgtggcacatataaaggacgaaagcagctgtcagtggtgggagtttgatgatgagtgt
gtatccaaacttggttttcacccctttggtgaaaaaccaagcaagtcatctgataaagtt
gatcagaaatctgaagttacttcttcggaaggttctgttgcaaatggtaataaaagtagc
tatcatgaggctaaaccgagttgtactatgggaccgatgttctcttctacagatgcttac
atgctgatgtacaaacgatccagcaaggatgagaacggtaccgagagcaataatatcatg
gaagccaataatagttcgcttccacgccattttgcggatgagattaatgaattgaatgca
ttatatgtaaaggaatgtgaggagtatgaaagtaagaaagataaacttttggcgtccata
caagagaggcgtgatgaagtaagagctgttcttacagaagcacctgctcccccagacgat
gattcatatttttggatttcagcagactggcttcgccaatgggcggataatgccaaccct
ccatcttcgattgacaatagtccaatacaatgtgaacatggaaaggttccagcatctaaa
gtcacatctatgaagcgattatcggctaaagcctggcagaagttactttccaaatatgga
ggaggaccagtattgagccgtaatgatgtctgcatggaatgcctcaaggatggagcaaaa
actgcagtgtctgctgatgtctatcgtgatcgaaaagcatcattgaaaaatctcgcagaa
gcagcacttgctggaattatcccagaaggaccttcttactttgtttcaaagacatggttg
acccattggttgcgaagaaaaaatgcggatatcccttctgatcctgataatgtaccaaca
agtgctctaagatgcagccatggggatcttcttccagagcacgctcctggggcaaagcgt
gtatctgtgccagagagtctatggctgtttctctatgaaaccgtcaatgcaagggaagct
gacaatattgcaacttttccatcagattgtcaaccatgcgaaatctgtggcgagaaattg
tcagttgttgcttctgttgaggataatcttagagcgataaaactcaagcaacgacagaga
catgaaaagttaatatctgggaaaggctttgcacttcaccctgggcaaaagtattatttg
gttccttcctcatggttgtcagaatggagaacttacattacggcgactggaaaaaatgtt
tcgtcgttaccagaacctcaaagtcttgaagttgttatcaattcacttaaatgtgagaag
cattcaagattgttgcaaaggcctctggatctagtttgtaaacgtgggaatatcacccag
aaaacatcaaatactgatgggttagcgatcatctcagaatcagattggatattattctct
gaagagtggaatataacacatgggaatggcgcatctgctgaaattatttgtagcaatagc
tctcaagataaattgcatgggtcatctgaagcgatgataattttggatgaagatccagac
cagtctattaatgatgcaaataattctttggaggacagttcaccctatatcagaaccgat
cctgaggtttgtgaagaatgtattggagaaatagagagctgtgcattggtgcagaaactc
aactaccagaacgaagatatccatgtctatcttgtgcgtggaaaagaggcaccaaagtca
attagagaggcatgtccagctcttcctattccagatcgtcggactacgaagcgttcccgg
agaacaacctcggggaactcgatcaatttaaaagtctctggttccacatctgtctatcag
ttgaaactcatgatatgggaatctctagggattgttaaggagaaccagaagcttcataaa
ggctctgttgagattgaagatgatcttgctactctcgctgacaaggctattttccctggg
gatgttctatgggtcaaagactctgaaatgtttgagaaccgtgatatagcagatgaaatc
tcagagcagaaggctgatgtatctgctgaggaaggcttccgtggtacactgctgacatcc
agtgtatcaactcagctttgtcaagacatagcattgagtgaatga

DBGET integrated database retrieval system