KEGG   Brachypodium distachyon: 100842556Help
Entry
100842556         CDS       T01717                                 

Definition
(RefSeq) protein disulfide isomerase-like 1-4
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bdi  Brachypodium distachyon
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100842556
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100842556
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100842556
  Exosomal proteins of colorectal cancer cells
   100842556
  Exosomal proteins of bladder cancer cells
   100842556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 559 aa AA seqDB search
MVSPRSLLLLLLLASPFLLLLLHASSDEDLDYIIHNAAADDLPADDEWLQEGSDDDQEES
DPFHQGDIDETHVFLLTAANFSDFLSSRRHVMVEFYAPWCGHCQALAPDYAAAASQLALL
HQDVVALSKVDATEDADLAQKYDVQGFPTILFFIDGVPKDYTGERTKEAIVAWINKKLGP
GVHNVTTVDEAEKIITGEDKAVLAFLDSLSGAHSNELAAASRLEDTINFYQTSNPDVAKL
FHIDPAAKRPSVVLLKKEEEKLTIYEGEFRASAIADFVSANKLPLITILTQETGPSIFDN
PIKKQILLFAVANESSEFLPIFKEVAKPFKGKLLFVFVERDNEEVGEPVANYFGITGQET
TVLAYTGNEDAKKFFLDGEMSLDNIKKFAQDFLEDKLTPFYKSEPIPEPNDEDVKIIVGK
NLDQIVLDESKDVLLEIYAPWCGHCQSLEPTYNKLAKHLRGIDSLVIAKMDGTTNEHPRA
KPDGFPTILFYPAGKKSFEPMTFEGDRTVVEMYKFIKKHASIPFKLKRPDSSAARTERAE
SSGSTEGEKSSGSNLKDEL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccccccgatctctcctcctcctcctccttctcgcctccccattcctcctcctc
ctcctccacgcatcctccgacgaggacctcgactacatcatccacaacgccgccgctgac
gacctccccgccgacgacgaatggctccaagagggctccgacgacgaccaggaagagtca
gaccccttccaccaaggcgatatcgacgagacccacgtcttcctcctcaccgccgccaac
ttctccgacttcctctcctcccgccgccacgtcatggtggagttctacgcgccctggtgc
ggccactgccaggcgctcgccccggactatgccgccgccgcctcccaactcgccctcctc
caccaggatgtcgtcgccctctccaaggttgacgctaccgaggacgccgaccttgcccag
aagtacgacgtccagggattccccaccatcctcttcttcatcgacggcgtccccaaggac
tacaccggagagaggaccaaggaggccatcgtggcttggatcaacaagaagctagggcct
ggagtgcacaatgtcaccaccgtcgacgaggccgagaagataatcaccggggaagacaag
gcagttctggccttccttgactccctatcgggtgctcacagcaatgagcttgctgctgct
tcaagactggaagataccatcaacttttaccagacttccaatcctgatgtagctaagctt
tttcacattgacccggcagcaaagcgcccatccgtagtcttgctgaagaaagaggaggag
aagttgaccatatatgagggagagttcagagcatctgccattgccgattttgtatctgcg
aacaaacttccactcattaccatcctcacacaggaaactggcccttcaatttttgataat
ccaatcaagaagcaaattttactatttgctgttgcgaatgagtcttcagaatttctgccc
atctttaaggaagtagcaaaaccattcaagggaaagcttttatttgtctttgtggagcga
gacaatgaggaagttggggaacctgttgccaattacttcggtattactggacaagaaacc
acagttcttgcttacactgggaatgaagatgctaagaaattttttcttgatggtgaaatg
tcacttgacaacattaagaaattcgctcaagatttcctggaggacaagcttacaccattc
tacaagtctgagccaatacccgaacctaatgatgaggatgtcaaaattattgttggcaag
aatctagatcaaatagttttggatgaatcaaaagatgtccttctggagatatatgcacca
tggtgtggacattgtcagtcactggagcctacctacaataagctagccaaacatctccgt
ggcatcgactctcttgtaatcgccaagatggatggcacaaccaatgagcatcctcgtgcc
aagcctgatggattccccacgatactcttctatccagctgggaagaaaagctttgagcct
atgacttttgagggggaccggacggtagtagagatgtacaagttcatcaagaagcatgct
agcatccctttcaagttgaagcgcccagactcatcagcggcacggaccgagagggctgag
agctcaggttcgactgagggcgagaagagctctggttcaaacctgaaggatgaattgtag

DBGET integrated database retrieval system