KEGG   Brachypodium distachyon: 100842850Help
Entry
100842850         CDS       T01717                                 

Definition
(RefSeq) triosephosphate isomerase, cytosolic
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100842850
   01230 Biosynthesis of amino acids
    100842850
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100842850
   00051 Fructose and mannose metabolism
    100842850
   00562 Inositol phosphate metabolism
    100842850
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100842850
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100842850
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100842850
  Exosomal proteins of bladder cancer cells
   100842850
  Exosomal proteins of melanoma cells
   100842850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 253 aa AA seqDB search
MGRKFFVGGNWKCNGTTDQVDKIVKVLNEGQIASTDVVEVVVSPPYVFLPIVKSQLRPEI
QVAAQNCWVKKGGAFTGEVSAEMLANLGIPWVILGHSERRSLLGESSEFVGEKVAYALAQ
GLKVIACVGETLEQREAGQTMDVVAEQTKAIAAKITDWTNVVVAYEPVWAIGTGKVATPA
QAQEVHANLREWLKTNVSPEVAESTRIIYGGSVTGASCRELAAQPDVDGFLVGGASLKPE
FIDIINSATVKSA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaagttcttcgtcggtggcaactggaaatgcaatggaaccaccgatcaggta
gacaagatcgtcaaggttctgaatgaaggacagatcgcctctacagatgttgttgaggtt
gttgtcagcccgccatatgttttccttcccattgtcaagagccagctgcgtcctgagatc
caggttgcggcacagaactgctgggtgaagaagggaggtgctttcaccggtgaagtcagt
gctgagatgcttgccaaccttggcattccctgggtcattcttggacactctgagaggagg
agcttgttgggagaatcaagcgagtttgttggagagaaagttgcatacgcactcgctcag
ggcttgaaggtcattgcatgtgttggcgagactctcgagcagcgggaagctgggcaaacc
atggatgttgttgctgaacagacaaaagcgattgctgcaaagatcacagattggactaac
gtagttgttgcgtatgagccagtgtgggccattggaaccggtaaagttgcaacaccagct
caggcacaggaagtgcatgccaacctcagggagtggctcaagaccaacgtcagcccagag
gttgctgaatccacacgcatcatctatggaggttctgtaactggcgcaagctgcagggag
ttggcagcacagccagacgtcgacggtttcctcgtcggtggagcttctttgaagcctgaa
ttcatcgacatcatcaactccgccaccgtgaagtctgcctaa

DBGET integrated database retrieval system