KEGG   Brachypodium distachyon: 100842850Help
Entry
100842850         CDS       T01717                                 

Definition
triosephosphate isomerase, cytosolic-like
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100842850
   01230 Biosynthesis of amino acids
    100842850
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100842850
   00051 Fructose and mannose metabolism
    100842850
   00562 Inositol phosphate metabolism
    100842850
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100842850
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100842850
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100842850
  Exosomal proteins of bladder cancer cells
   100842850
  Exosomal proteins of melanoma cells
   100842850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 253 aa AA seqDB search
MGRKFFVGGNWKCNGTTDQVDKIVKVLNEGQIASTDVVEVVVSPPYVFLPIVKSQLRPEI
QVAAQNCWVKKGGAFTGEVSAEMLANLGIPWVILGHSERRSLLGESSEFVGEKVAYALAQ
GLKVIACVGETLEQREAGQTMDVVAEQTKAIAAKITDWTNVVVAYEPVWAIGTGKVATPA
QAQEVHANLREWLKTNVSPEVAESTRIIYGGSVTGASCRELAAQPDVDGFLVGGASLKPE
FIDIINSATVKSA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaagttcttcgtcggtggcaactggaaatgcaatggaaccaccgatcaggta
gacaagatcgtcaaggttctgaatgaaggacagatcgcctctacagatgttgttgaggtt
gttgtcagcccgccatatgttttccttcccattgtcaagagccagctgcgtcctgagatc
caggttgcggcacagaactgctgggtgaagaagggaggtgctttcaccggtgaagtcagt
gctgagatgcttgccaaccttggcattccctgggtcattcttggacactctgagaggagg
agcttgttgggagaatcaagcgagtttgttggagagaaagttgcatacgcactcgctcag
ggcttgaaggtcattgcatgtgttggcgagactctcgagcagcgggaagctgggcaaacc
atggatgttgttgctgaacagacaaaagcgattgctgcaaagatcacagattggactaac
gtagttgttgcgtatgagccagtgtgggccattggaaccggtaaagttgcaacaccagct
caggcacaggaagtgcatgccaacctcagggagtggctcaagaccaacgtcagcccagag
gttgctgaatccacacgcatcatctatggaggttctgtaactggcgcaagctgcagggag
ttggcagcacagccagacgtcgacggtttcctcgtcggtggagcttctttgaagcctgaa
ttcatcgacatcatcaactccgccaccgtgaagtctgcctaa

DBGET integrated database retrieval system