KEGG   Brachypodium distachyon: 100842872Help
Entry
100842872         CDS       T01717                                 

Definition
6-phosphofructokinase 5, chloroplastic-like
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bdi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bdi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bdi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bdi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bdi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bdi00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 527 aa AA seqDB search
MAIASPVDYAGPITSGQRRLSCFPVHSCNHLRCNAYEKKSRTSDQLVIRAISVDRPQLDF
SIPDWKNLFQEDFDRRFSLPHLTDVIHLEPRPTTFSLKSSRTPLENGSGPFDESWNGYVN
DDDRALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQSVKAGIVTCGGL
CPGLNDVIRQIVLTLEKYGVKNIVGIQHGFRGFFEDHLSEVPLNRHVVQNINLSGGSFLG
VSRGGASVSDIVDSIQARRLDMLFVLGGNGTHAGANAIHEECRKRKLKVSIVGVPKTIDN
DILLMDKTFGFDTAVEAAQRAINSAYIEAHSAFHGIGLVKLMGRSSGFITMHASLSSGQV
DICLIPEVPFTLDGPNGVLRHLEHLIDTKGFALICIAEGAGQEYLQKSNATDASGNMVLS
DIGAHLQQKIKSHFNEIGVHSDVKYIDPTYMLRAVRANASDAILCTVLGQNAVHGAFAGF
SGITTGVCNTHNVYLPIPEVIKSTRFVDPNSRMWHRCLTSTGQPDFH
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggctatagcatcgccagtggactatgctggcccaatcacttcaggccagaggcgcctc
agttgtttcccagtgcacagctgcaatcacttacgttgtaatgcatatgaaaagaaatcg
agaacgtcagatcagttggtcatcagagccatatctgtggatcgcccacaactggacttc
tcgattccggattggaagaatctattccaagaggattttgataggcggttcagtttgcca
cacttgaccgatgtaattcatttggagccgaggccaacgacattttccctcaagagcagc
aggactcctctggagaatgggagcggtccttttgatgaatcatggaacggctatgttaat
gatgatgacagagcacttttgaaggtcattaagtttgcctcgccaacgtctgctggagct
gactgcattgaccctgattgcagctgggttgaacaatgggtgcaccgtgctggcccgcgc
aaacagatatattttgagcctcagagtgtaaaggctggaattgttacctgtggtggactt
tgccctggtctcaatgatgttatccggcagattgtgcttacacttgaaaaatatggagtg
aagaacattgttgggatacagcatggtttccgtggattttttgaagatcatttatcagaa
gtcccccttaatagacatgtcgtccaaaatatcaatctttctggtggcagcttcttagga
gtttctcgtggtggggcaagtgtttcagacattgtcgacagcatccaggccaggaggctt
gacatgctctttgtacttggtggaaatggaactcatgctggagctaatgctatacatgag
gagtgccgcaagagaaaactcaaagtgtcgattgtgggcgtcccaaaaacaattgataat
gacatactgctgatggacaagacattcggatttgatactgcagtggaagcagcacaaaga
gctatcaactctgcgtatattgaggcacattctgcttttcatggtattgggttggtcaag
ctgatgggaagaagcagtggcttcatcacaatgcatgcttccctatcaagtggacaagtt
gatatctgcctgatacctgaggtaccgttcactcttgatggtcccaacggagttcttcga
catcttgagcacttgattgacaccaaggggtttgctctgatttgtattgccgaaggagct
gggcaggaatatctgcaaaagtcgaacgcaactgatgcttcagggaacatggttcttagt
gatatcggcgcgcaccttcaacagaagatcaagtctcatttcaatgaaataggcgtccac
tctgatgtgaagtacattgatcctacgtacatgcttcgtgcggtgcgtgccaacgcatct
gatgccatcctgtgcacggtgctcggtcagaatgctgttcatggcgcctttgcagggttc
agcggcatcacgactggagtatgcaacacacataacgtctacttgccaataccagaagtg
atcaagtctacaaggtttgtcgatccaaacagccggatgtggcaccgttgcttgacatcc
acgggccagccagacttccactga

DBGET integrated database retrieval system