KEGG   Brachypodium distachyon: 100842910Help
Entry
100842910         CDS       T01717                                 

Definition
endoglucanase 10-like
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bdi  Brachypodium distachyon
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bdi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 621 aa AA seqDB search
MFGRDPWGGTLEISNADSATDDDRSRDLDRGALMRHQLDETQQSWLLAGPGDQAGKKKKK
YVDIGCMVIDRKIFLWTVGTILGVGLFIGFVMMIVKLVPHKKPPPPPPDQYTQALHKALM
FFNAQRSGPLPKHNGVSWRGNSGMKDGLSDSTARKSLVGGFYDAGDAIKFNFPMAWSMTM
LSWTVIEYKAKYEAIGELDHVKEVIKWGTDYILKTFNSSADTIDRIVAQVGVGDTSKGPM
PNDHYCWMRPEDIDYKRPVIECHSCSDLAAEMAAALASASIVFKDNKKYSDKLVHGAKAL
YKFGRLQRGRYSPNGSDQSLFYNSTSYWDEFVWGGAWMYFATGNTSYLTIATAPGMAKHA
GAFWLGSPNYGVFTWDDKLPGSQVLLSRLRLFLSPGYPYEEILRTFHNQTDNVMCSYLPQ
FESFNFTKGGLIQLNHGRPQPLQYVVNAAFLASLYADYLDTADTPGWYCGPHFFKTDVLR
KFAKSQIDYILGNNPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWRESKKA
NPNILVGAMVAGPDRHDGFKDIRTNYNYTEPTLAANAGLIAALISLADIDTGRTAIDKNT
IFSAVPPMFPTPPPPPSAWKP
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgttcgggcgggacccatggggcgggacgctggagatctcgaacgcggactcggcgacg
gacgacgaccggagcagggacctggacaggggcgcgctgatgcggcaccagctggacgag
acgcagcagagctggctgctggccggccccggcgaccaggccgggaagaagaagaagaag
tacgtcgacatcggctgcatggtcatcgaccgcaagatcttcctgtggaccgtcggcacc
atccttggcgtcggcctcttcatcggcttcgtcatgatgatcgtcaagctcgtcccgcac
aagaagcccccgccgccgccgcccgaccagtacacccaggcgctgcacaaggcgctcatg
ttcttcaacgcgcagcgatctggtccgctgcccaagcacaacggcgtcagctggaggggc
aactccggcatgaaggacggcctctctgatagcaccgcccggaaaagcttggtcggaggc
ttctacgatgcaggggacgccatcaagttcaacttccccatggcctggtccatgaccatg
ctcagctggactgtgatcgagtacaaggccaagtacgaggccatcggcgagctcgaccat
gtcaaggaggtgatcaagtggggaacagactacatcctcaagacattcaactcatccgcc
gataccatcgatcggatcgtcgcccaggtgggtgtaggtgacacctctaaaggtcccatg
cctaatgaccactactgctggatgagaccagaggatatcgattacaaaaggcctgtcatt
gagtgccactcttgctcggatcttgctgctgaaatggctgctgcccttgcttctgcctcc
atagtgttcaaggacaacaagaaatactctgacaaactcgtccacggtgcgaaggcgctg
tacaagtttggcagactgcagcggggacgatacagccccaatggctctgatcagtcactg
ttctacaattccaccagctactgggatgagtttgtgtggggtggtgcttggatgtacttt
gccacggggaacacatcatacctcacaatcgccacagctccaggaatggcaaagcatgct
ggagcgttttggcttggtagtccaaactatggagtatttacctgggatgacaaacttcca
ggatctcaggttcttctcagcagactgcggctcttcctaagtccaggatacccttacgaa
gaaatattaaggacattccacaaccaaactgacaatgttatgtgctcatatttacctcaa
ttcgagtctttcaacttcactaaaggaggattaatacagctcaaccatggaaggcctcag
ccacttcagtatgttgtcaatgcagccttccttgcctctttgtatgctgattacctggac
actgcagatacaccagggtggtattgtggacctcatttctttaagacggatgtgctccgc
aagtttgcaaagtcgcagattgattacatccttggcaataatccacaaaaaatgagctat
gtcgtgggttttggaaagaagtaccccaagcgtgttcatcacagaggggcatcaatcccc
cataacggtgtcaagtacggatgcaaaggaggtttcaaatggagggagtctaagaaggca
aacccaaatatccttgttggagcaatggtcgctggtcctgacaggcatgatggcttcaaa
gatatccgcacaaactacaattacacagagccaactcttgcagcaaatgctggcttgatt
gcagcactgatttctctagcggacatcgatactggcagaactgcaattgataagaacacc
atcttctcagcagttcccccaatgttcccaactcccccaccaccaccatcagcctggaaa
ccgtga

DBGET integrated database retrieval system