KEGG   Brachypodium distachyon: 100842984Help
Entry
100842984         CDS       T01717                                 

Definition
Pyruvate dehydrogenase [lipoamide] kinase-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100842984
Protein kinases [BR:bdi01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100842984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 363 aa AA seqDB search
MASEPVARAVAEEVARWGGMKQTGVSLRYMMEFGARPTERNLLLSAQFLHKELPIRIARR
ALDLDSLPFGLSRKPAVLKVRDWYLDSFRDIRYFPEVRNRDDEHAFTQMIKMIRVRHTNV
VPTMALGVQQLKKDLGGTKAFPAGIDEIHQFLDRFYMSRIGIRMLIGQHVALHDPDPEPG
VIGLISTRLSPMLVARQASEDARAICMREYGSTPDVNIYGDPDFTFPYVTPHLHLMMFEL
VKNSLRAVQERFMDSDKHAPPIRIIVADGAEDVTIKISDEGGGIPRSGLPRIFTYLYSTA
EHPPDLDGHNEGVTMAGYGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSEE
PLP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggaaccggtggcgcgggcggtggcggaggaggtggcccggtggggcgggatg
aagcagacgggggtcagcctgcggtacatgatggagttcggggcgcggcccacggagcgc
aacctgctgctctccgcgcagttcctgcacaaggagctccccatccgcatcgccaggcgc
gcgctcgacctcgactccctacccttcggcctctcccgcaagcccgccgtcctcaaggtg
agagattggtacttggattcattccgtgacatccggtactttccggaggtgaggaaccgg
gacgatgagcacgcattcacccagatgatcaagatgatcagggtgcggcacaccaatgtg
gtgcccaccatggcgctgggtgtgcagcagctgaagaaggacctgggtggtacaaaggcg
ttccctgctggaattgatgagattcatcagttccttgatcgtttctacatgtcaaggatt
gggatccgcatgctgatagggcagcatgttgctttgcatgatcctgatccagagcctggt
gtcatagggctcataagcacaagattgtcccccatgctagtagctcgacaagccagtgaa
gatgcacgtgctatttgcatgcgggaatatggatcaactcctgacgtcaatatatatgga
gacccagattttacatttccatatgtgacaccacatctacatctcatgatgtttgaattg
gtgaagaattcccttcgtgcagtacaagaacgttttatggactctgataaacatgcacct
ccaattaggatcatagttgcggatggagcagaggatgtaactatcaagattagtgatgaa
ggtggtggaataccaagaagtggccttccaagaatttttacatatctctacagtacagca
gaacacccacctgatctagatggccataatgaaggagtaactatggctgggtatggttat
gggctgcccattagtcgtctttatgcccgatattttggtggggacttgcaaatcatttct
atggagggatatggaactgatgcttatctccacctatcacggctgggagattcagaggag
cccttgccttag

DBGET integrated database retrieval system