KEGG   Brachypodium distachyon: 100842984Help
Entry
100842984         CDS       T01717                                 

Definition
Pyruvate dehydrogenase [lipoamide] kinase-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 363 aa AA seqDB search
MASEPVARAVAEEVARWGGMKQTGVSLRYMMEFGARPTERNLLLSAQFLHKELPIRIARR
ALDLDSLPFGLSRKPAVLKVRDWYLDSFRDIRYFPEVRNRDDEHAFTQMIKMIRVRHTNV
VPTMALGVQQLKKDLGGTKAFPAGIDEIHQFLDRFYMSRIGIRMLIGQHVALHDPDPEPG
VIGLISTRLSPMLVARQASEDARAICMREYGSTPDVNIYGDPDFTFPYVTPHLHLMMFEL
VKNSLRAVQERFMDSDKHAPPIRIIVADGAEDVTIKISDEGGGIPRSGLPRIFTYLYSTA
EHPPDLDGHNEGVTMAGYGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSEE
PLP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggaaccggtggcgcgggcggtggcggaggaggtggcccggtggggcgggatg
aagcagacgggggtcagcctgcggtacatgatggagttcggggcgcggcccacggagcgc
aacctgctgctctccgcgcagttcctgcacaaggagctccccatccgcatcgccaggcgc
gcgctcgacctcgactccctacccttcggcctctcccgcaagcccgccgtcctcaaggtg
agagattggtacttggattcattccgtgacatccggtactttccggaggtgaggaaccgg
gacgatgagcacgcattcacccagatgatcaagatgatcagggtgcggcacaccaatgtg
gtgcccaccatggcgctgggtgtgcagcagctgaagaaggacctgggtggtacaaaggcg
ttccctgctggaattgatgagattcatcagttccttgatcgtttctacatgtcaaggatt
gggatccgcatgctgatagggcagcatgttgctttgcatgatcctgatccagagcctggt
gtcatagggctcataagcacaagattgtcccccatgctagtagctcgacaagccagtgaa
gatgcacgtgctatttgcatgcgggaatatggatcaactcctgacgtcaatatatatgga
gacccagattttacatttccatatgtgacaccacatctacatctcatgatgtttgaattg
gtgaagaattcccttcgtgcagtacaagaacgttttatggactctgataaacatgcacct
ccaattaggatcatagttgcggatggagcagaggatgtaactatcaagattagtgatgaa
ggtggtggaataccaagaagtggccttccaagaatttttacatatctctacagtacagca
gaacacccacctgatctagatggccataatgaaggagtaactatggctgggtatggttat
gggctgcccattagtcgtctttatgcccgatattttggtggggacttgcaaatcatttct
atggagggatatggaactgatgcttatctccacctatcacggctgggagattcagaggag
cccttgccttag

DBGET integrated database retrieval system