KEGG   Brachypodium distachyon: 100843029Help
Entry
100843029         CDS       T01717                                 

Definition
delta-aminolevulinic acid dehydratase, chloroplastic-like
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bdi  Brachypodium distachyon
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bdi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 427 aa AA seqDB search
MASTVSFSPAKVQMLQATNSHVRAAPSSCFAVPRTGPRPRSTGVRVSSEQEAAATVRAPS
GRSIEECEADAVAGRFPAPPQFVRPKAPDGTPEIRPLDMAKRPRRNRRSPSLRAAFQETS
ISPANLVLPLFIHEGEEDAPIGAMPGCFRLGWQHGLLDEVYKARDVGVNSFVLFPKVPDA
LKSPTGDEAYNDNGLVPRTIRLLKDKFPDIVVYTDVALDPYSSDGHDGIVREDGVIMNDE
TVYQLCKQAVSQARAGADVVSPSDMMDGRIGAIRSALDAEGFNDVSIMSYTAKYASSFYG
PFREALDSNPRFGDKKTYQMNPANYREALLETAADEAEGADILLVKPGLPYLDIIRLLRD
NSALPIAAYQVSGEYSMIKAGGAQNMIDEEKVMMESLMCLRRAGADIILTYFARQAAGVL
CGMRSSK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaccgtctccttctccccggccaaggtccagatgctccaggctacgaactcc
cacgtccgtgcggcacccagtagctgtttcgctgtcccaagaaccgggccaaggccgcgt
tccacgggcgttagagtcagcagcgaacaggaggcggctgccaccgtgagggcgccgtcc
ggtaggagcatcgaggagtgcgaggccgacgccgtcgctgggagattcccagctcccccg
cagtttgttagaccgaaggcccctgacggaaccccggagatcaggcctcttgacatggca
aagcgacctcgtcgcaaccgcaggtcaccgtctcttagggctgcattccaggagacaagc
atatcacccgctaatttggtgctcccattgtttatccatgaaggggaagaggatgctcct
attggtgctatgccggggtgctttaggcttggatggcagcatgggcttcttgatgaggtt
tacaaggcacgtgatgttggtgttaacagttttgtgctctttccaaaagttcctgatgca
ctgaagtctccaacaggagatgaagcatataatgacaatggtttggttccgcgaacaatc
cgtctgctcaaggataagttccctgacattgttgtctacacggatgttgctttggatcct
tattcatctgatggtcatgatggcattgtgagagaagatggagtaattatgaacgatgaa
acagtttatcagttgtgcaaacaggcagtttcacaggcacgcgctggtgccgatgtagtc
agccctagtgacatgatggatggccgcattggagcaattcgttctgctttggatgcggag
ggtttcaatgatgtctccattatgtcctacaccgcaaagtatgccagttcattttatggt
ccattcagagaagctttagattcaaatccacgatttggggacaagaagacctatcagatg
aacccagctaactacagagaagcccttctagaaactgcagcagatgaggcagaaggggct
gatattcttctagtaaaacctggattaccgtacttggacatcatcagacttcttcgggat
aattctgcactgccaattgctgcataccaggtttctggggagtactcgatgatcaaagct
ggcggggcacagaacatgatcgacgaggagaaggtgatgatggagtcgctcatgtgcctc
aggcgagccggcgctgacatcatcctgacctacttcgcccgccaggccgccggcgtgctg
tgcggcatgagatcctccaaatag

DBGET integrated database retrieval system